KEGG   Rattus norvegicus (rat): 293688Help
Entry
293688            CDS       T01003                                 

Gene name
Tm7sf2
Definition
(RefSeq) transmembrane 7 superfamily member 2
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00100  Steroid biosynthesis
rno01100  Metabolic pathways
Module
rno_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    293688 (Tm7sf2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     293688 (Tm7sf2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Motif
Other DBs
NCBI-GeneID: 293688
NCBI-ProteinID: NP_001013089
RGD: 1311205
Ensembl: ENSRNOG00000020989
UniProt: Q5BK21
Position
1q43
AA seq 418 aa AA seqDB search
MASREASQAPLEFGGPLGVTAMLILLPATMFHLLLAARSGPARLLALPAYLPGLEELWSP
RALLLLFIWLGLQVALYLLPARKVAEGLELKDKSRLRYPINGFQALVLTALLVGLGVSVG
LPLGALPGMLLPLAFATTLTSFIFSLLLYAKALVAPASALAPGGNSGNSVYDFFLGRELN
PRLGSFDFKYFCELRPGLIGWVFINLALLMQEAELRGSPSLAMWLVNGFQLLYVGDALWY
EESVLTTMDIIHDGFGFMLVFGDLAWVPFTYSLQAQFLLYHPQPLGLPMALLICLIKAVG
YYIFRGANSQKNTFRKNPSDPSVAGLETIPTATGRQLLVSGWWGMVRHPNYLGDLIMALA
WSLPCGLSHLLPYFYLLYFTALLVHREARDEQQCLRKYGRAWQEYCKRVPYRIIPYVY
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggcttctcgtgaggcctcccaggccccactggaattcggggggccgttgggcgtcacg
gcgatgctgatcctgctgcctgccaccatgttccacctgcttctggcggcccgctcgggt
ccggcgcgcctcctggccctaccagcctatctgcctgggctggaggagctgtggagccca
cgggctctgctgctgttgttcatctggctcggcctgcaggtggcgctctatttgctgcct
gcacgcaaggtggccgaggggctggaactgaaggacaagagtcgcctgcgctaccctatt
aatggtttccaggctctggtgctaacagccctgttggtggggctaggggtgtcagttggg
ctgcccctgggggcactccctggaatgctcctgcccctggcctttgcgaccactctcacc
agctttatcttcagcctccttctctatgcaaaggctttggtagctcctgcctcagccctg
gctcctgggggaaactcaggaaattctgtgtatgacttctttctcggacgggagctgaac
cctcgcctcggttcctttgacttcaaatatttctgtgagctgcgacctggcctcatcggc
tgggtcttcattaacctggccctgctgatgcaggaggcggagcttcgggggagtccttca
ctggctatgtggctggtcaatggcttccagttgctgtatgtgggtgatgccctctggtat
gaggagtctgttctcaccaccatggacataatacatgatggttttggcttcatgctggtc
tttggagacctggcctgggtaccattcacctacagcctgcaggcccagttcctgttgtac
catccacagcctctgggattgcccatggccttgctcatctgcctcattaaggctgttggt
tactacatcttccgaggggccaattcccagaaaaatacattcagaaagaatccttctgac
cccagtgtggctggtcttgagaccatccctactgccacggggaggcagctgttggtgtct
gggtggtggggtatggttcgacaccccaactacctgggagacctcatcatggctctggct
tggtccttgccctgtgggctgtcccacctgctgccctacttctacctgctctacttcact
gcactgctggtgcaccgcgaggcccgagatgagcagcagtgcctgcgaaagtatggccgt
gcctggcaggaatactgcaagcgcgtgccttaccgaatcataccgtatgtctactga

DBGET integrated database retrieval system