KEGG   Rattus norvegicus (rat): 293693Help
Entry
293693            CDS       T01003                                 

Gene name
Cdc42bpg, RGD1307260
Definition
(RefSeq) CDC42 binding protein kinase gamma
  KO
K16307  serine/threonine-protein kinase MRCK [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    293693 (Cdc42bpg)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     293693 (Cdc42bpg)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   293693 (Cdc42bpg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CNH Pkinase_Tyr DMPK_coil C1_1 Kinase-like PH Kdo Pkinase_C PBD Pkinase_fungal Haspin_kinase Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 293693
NCBI-ProteinID: NP_001123485
RGD: 1307260
Ensembl: ENSRNOG00000027456
UniProt: D3Z837
Position
1q43
AA seq 1551 aa AA seqDB search
MEQRLRALEQLVRGEAGGSPGLDGLLDLLLGVHQELSSAPLRRERNVAQFLSWAGPFVTK
VKELRLQRDDFEILKVIGRGAFGEVAVVRQRDSGQIFAMKMLHKWEMLKRAETACFREER
DVLVKGDSRWVTALHYAFQDEEYLYLVMDYYAGGDLLTLLSRFEDRLPPELAQFYLAEMV
LAIHSLHQLGYVHRDVKPDNILLDMNGHIRLADFGSCLRLNNNGMVDSSVAVGTPDYISP
EILQAMEEGKGHYGPQCDWWSLGVCAYELLFGETPFYAESLVETYGKIMNHEDHLQFPSD
VDDVPASAQALIRQLLCRQEERLGRGGLDDFRSHPFFEGVDWERLATSTAPYIPELRGPV
DTSNFDVDDDTLNRPETLPPSSHGAFSGHHLPFVGFTYTSGSLTDDKSSELMATPEWKPH
GVEQMKVELSQKCQEALHSSLQPQELVRLQKEVQVLQEKLTETLRDSKASLSQADGLHVR
SPAPDIQLQQEKDRLQQELAEAQAALQVRDAELCQAQNRQEEFLQRLWEAQEREAAAASQ
IQALNSQLEEAWVVRRELEGQVNTLSQEVTQLQGQCKQDSSSQAKTVHAAPETNGIGSPE
GQSQEAQLRKEVAALREQLECACSQGVNVGKEEVLCRLQEENQRLSREQERLAEELDLEL
QSRQRLEGERRESESNWEAQIADILSWVNDEKVSRGYLQALATKMAEELESLRNVGTQTL
PTRPLDHQWKARRLQKMEASARLELQSALEAEIRAKQGLQEQLTQVQEAQRQAERRLQEA
EKQNQALQQEVAELREELQARGPGDAKPCTSLIPLLSFWNTEKDSAKDPGNSGESPRSGA
EAELRPEGRRSLRMGSVFPRVPAANPTPAEGPPAKPGSHTLRPRSFPSPTKCLHCTSLML
GLGRQGLGCDTCGYFCHSACATQAPPCPVPPELLRTALGVHPETGTGTAYEGFLSVPRPS
GVRRGWQRVYAALSDSRLLLFDAPDPRGSMASGVLLQALDLRDPQFSATPVLAPDVIHAQ
SKDLPRIFRVTASQLTVPPSTCTVLLLAENEGERERWLQVLSELQRLLLDARPRPRPVYT
LKEAYDNGLPLLPHTLCAAIIDRERLALGTEEGLFVIHLHSNDIFQVGDCRRVQRLTVSS
AAGLLVVLCGRGPSVRLFTLSELENAEVAGAKIPESRGCQALVAGSILQARTPVLCVAVK
RQVLCYQLGPGPGPWQRRIRELQAPAPVQSLGLLGDRLCVGAAGTFALYPLLNEAAPLAL
GTGLVAEELPASRGGLGEALGAVELSLSELLLLFATAGVYVDGAGRKSRSHELLWPVAPT
GWGYTAPYLTVFSENSIDVFDVRRAEWVQTVPLKKVRPLNPEGSLLLYGTEKVRLTYLRN
PLAEKDEFDIPDLTDNSRRQLFRTKSKRRFFFRVSDELRQQQRREMLKDPFVRSKFISPP
TNFNHLVHVGPTEGRPGPRDGTRAQEQKSRGTRSSGPQRPHSFSEALRRPVSMGNDGLPG
ETDPLKRKVWTSLSSESVSCPQGSLSPAASLIQVSERPRSLPPDPESEGSP
NT seq 4656 nt NT seq  +upstreamnt  +downstreamnt
atggagcagcggctgcgtgcgctggagcagttggtacggggcgaggctggtggcagcccg
gggctcgacggcctcctggatttgctgctgggggtgcaccaggagctcagcagcgccccc
ctgcgccgggagcgtaacgtggcgcagtttctgagctgggctggcccctttgtaacaaaa
gtgaaagagctgcgtttacagagagatgactttgagatcttgaaggtgattggcagaggg
gcctttggggaggttgctgtggtgaggcagagggacagtggccagatttttgccatgaag
atgctgcataagtgggagatgctgaagagggctgagacggcctgtttccgggaggagcga
gatgttctagtgaagggagatagccgctgggtgactgctctgcactacgccttccaagat
gaggagtacctgtacctggtgatggactactacgctggcggggacctcctcacactgctg
agccgcttcgaggatcgcctcccacctgagctggcccagttctatctggctgagatggtt
ctggccatccactctctgcaccagctgggctatgtccacagggatgtcaagcctgacaac
atcctgctggacatgaatggccacatccgcctggcagactttggctcctgcctgcgtctc
aacaacaatggcatggtggattcatcagtcgcagttgggaccccggactacatctctcct
gagatcctacaggccatggaggaaggcaagggccactacggcccacagtgtgactggtgg
tccctgggagtctgcgcctacgagctgctctttggggaaacacccttttatgcagagtct
ctggtagaaacctacggcaagatcatgaaccacgaggaccacctccagttcccctctgat
gtagatgacgtgcctgctagtgcccaggccctgatccggcagctgctgtgccgtcaggag
gagcggctgggccgcggtggactggacgacttccggagccacccgttctttgaaggggtt
gattgggagagacttgcaaccagcacagcaccctacatccctgagcttcgcgggccggtg
gatacctccaacttcgatgtggatgatgataccctcaaccgtccagagacgctgccaccg
tcctcccacggggccttctcaggccaccacctgccatttgtaggcttcacttatacctca
ggcagcctcactgatgacaagagctctgagctaatggctaccccagagtggaagccccac
ggtgtggagcagatgaaagtggagctcagccagaagtgtcaagaggccctgcatagctca
ttacaaccccaggagctggtgcgactgcagaaagaagtacaggttcttcaggagaaactg
acagagacactgagggacagcaaggcctcactctcacaggctgatggcctccatgttaga
agcccagccccagacatccaactacaacaggagaaggaccgcctccagcaggagctggct
gaagctcaggcagcattgcaagtgcgggatgctgaactgtgccaagcccagaaccgacag
gaagaattcctacagaggctgtgggaagcccaagagagagaggcagctgcagccagtcag
atccaggccctgaactcccagctggaggaagcctgggttgtccggagagagcttgaaggc
caggtgaacaccctgagtcaggaggtgacacagctccagggacaatgtaaacaagactct
tcttcacaggccaagaccgttcatgcagcccctgagaccaacggcataggatctcctgag
ggtcagtctcaagaggcccagctgaggaaggaggtggctgctctgagggagcagctggag
tgcgcctgcagccaaggggtcaatgttgggaaagaggaggttctgtgccgactgcaggag
gaaaaccagcggctgagccgggagcaggaacggttggcagaggagctggacctggagcta
cagagcagacagcgtctggaaggtgagcggcgtgagagtgagagcaactgggaggcgcag
attgctgacatcctcagctgggtgaatgacgagaaggtctcgagaggctacctgcaggcc
ttggctactaagatggccgaggagctggagtccttgaggaatgtgggcacccaaacactc
cctacccggcctctggaccaccagtggaaggctcggaggctgcagaagatggaggcctca
gcccggcttgagcttcagtcagcactggaagctgagatccgtgccaagcagggtctgcag
gagcagctgacgcaggtgcaggaggcccagcggcaggctgaacgccgccttcaagaggct
gagaagcaaaaccaggccctgcagcaggaggtggctgagctccgggaggaacttcaagct
cgaggaccaggggatgccaagccctgtacctccctcatccctctcctgtccttctggaac
acagagaaggattctgccaaggaccctggcaattcaggagagtccccccggtctggagca
gaagcagagctgaggccagagggccgccgcagtttgcgcatggggagtgtgttccccagg
gtgcctgctgccaaccctacccctgcagagggtcctcctgctaagcctggttctcacaca
ctgcgtccccggagttttccatcccctaccaagtgtctccactgcacctcgctgatgttg
ggcctgggccgccagggcctgggctgtgacacctgtggctacttctgccactcagcttgt
gcgacccaagccccaccctgccctgtgccccctgaactcctccgcacagccctgggggtg
cacccggaaacaggcacaggcactgcctatgagggcttcctgtcggtgcctcggccttca
ggtgtccgtcggggttggcagagggtgtatgctgctctcagtgactcccgcctgttgttg
tttgacgctcctgaccctcgaggcagcatggccagtggggtcctcctgcaggccttggat
ctgagggatccccagttctcagccacccctgtcttagctccagatgtcatccatgcccaa
tccaaggacctgccacgcatctttagggtgacagcctcccagctgacagtgccaccatcc
acatgtactgtgctgctgctggcagagaacgagggggagcgggagcgttggcttcaggtg
ctaagtgagctgcagcggctgctcctggacgcacgcccaaggccccgaccagtgtacaca
ctcaaggaggcctatgacaatggactgccgctgctgcctcatacgctctgtgctgctatc
attgaccgagagcgtcttgccctgggcactgaggagggcttgtttgtgatccatcttcac
agcaatgacatcttccaggtgggagactgccgcagggtgcagcggttgaccgtgagctct
gccgctggcctactggtcgtgctctgtggccgtggtcccagtgtgcgcctcttcaccctg
tctgagctggaaaatgcagaggtggcaggtgccaagatccctgaatcccgaggctgtcag
gctttggtggctgggagcatcctacaggcccggactccagtgctctgtgtggcagtcaag
cgccaagttctctgttaccagctgggcccaggaccagggccctggcagcgccgcatccga
gagctacaagcgccagctcccgtgcagagcctggggttgctgggtgatcggctctgtgtg
ggtgccgctggcacctttgctctctacccgctgctcaatgaggctgcgcccttagcgctg
ggaaccggcctggtggctgaggagctccccgcgtcccgtgggggcctgggtgaggcactg
ggtgctgtggagctcagcctcagcgagcttctgctgctcttcgccactgctggcgtctac
gtggatggcgctggccgcaagtcacgaagccacgagctgctgtggccagtggcacccact
ggctggggttacacagcaccctacctaacagtgttcagtgaaaactccattgatgtgttt
gatgtgaggagagcagaatgggtacagactgtgccactcaagaaggtaagacccctaaat
ccagaaggctccttgctcctctatggcaccgagaaggtccgtctgacctacctcaggaat
ccattagcagagaaggatgagtttgacattcccgacctcacggacaacagccggcgccag
ctgttccgcaccaagagcaagcgccgcttcttcttccgggtgtctgacgagctgcggcag
cagcagcgcagggagatgctgaaggacccttttgtgcgctccaagttcatctcaccgccc
accaacttcaaccacctggtgcacgtgggccctacagagggcaggcccggccccagggat
gggacccgggctcaggaacagaagagcagaggcacccgcagctccggaccgcagcggccc
cacagcttctcagaggcattgcggcgtccagtatccatgggcaatgatggcctccctgga
gaaacagaccccctgaagaggaaagtttggacatctctgtccagcgaatccgtgtcctgc
ccccaggggtccctgagccctgcagcatccctgatacaggtctcagaacggccccggagt
ctccctccagatcctgagtcagagggctccccctga

DBGET integrated database retrieval system