KEGG   Rattus norvegicus (rat): 293702Help
Entry
293702            CDS       T01003                                 

Gene name
Fkbp2, RGD1560660
Definition
(RefSeq) FK506 binding protein 2
  KO
K09569  FK506-binding protein 2 [EC:5.2.1.8]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    293702 (Fkbp2)
Enzymes [BR:rno01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     293702 (Fkbp2)
Chaperones and folding catalysts [BR:rno03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    293702 (Fkbp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-GeneID: 293702
NCBI-ProteinID: NP_001127900
RGD: 1560660
Ensembl: ENSRNOG00000021153
UniProt: D3ZZR9
Position
1q43
AA seq 140 aa AA seqDB search
MRLSWILTVLSICLSALVTATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLED
GTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIP
GGATLVFEVELLKIERRSEL
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgagctggatcctgacagtactgtccatttgcctgagtgccctggtcacagcc
acaggggccgaaggcaagcggaagctgcagattggagtgaagaaacgtgtggatcactgt
cccatcaagtctagaaagggagatgtcttacacatgcattacacgggaaagctagaagat
gggacggagtttgacagcagcctaccacagaaccagccctttgttttctcccttggcact
ggccaggtcatcaagggctgggaccaggggctactggggatgtgtgaaggggaaaagcgg
aagctagtgatcccgtctgagctggggtatggagagcggggagcccccccaaagatacca
ggtggagcaaccctggtgtttgaggtggaactgctcaagattgagagacgttcagaactg
tag

DBGET integrated database retrieval system