KEGG   Rattus norvegicus (rat): 293705Help
Entry
293705            CDS       T01003                                 

Gene name
Otub1
Definition
(RefSeq) OTU deubiquitinase, ubiquitin aldehyde binding 1
  KO
K09602  ubiquitin thioesterase protein OTUB1 [EC:3.4.19.12]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rno01002]
    293705 (Otub1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    293705 (Otub1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     293705 (Otub1)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C65
   293705 (Otub1)
Ubiquitin system [BR:rno04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   OTU
    293705 (Otub1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C65 OTU Lipoprotein_7 RE_XcyI
Motif
Other DBs
NCBI-GeneID: 293705
NCBI-ProteinID: NP_001099802
RGD: 1311329
Ensembl: ENSRNOG00000021175
UniProt: B2RYG6
Position
1q43
AA seq 271 aa AA seqDB search
MAAEEPQQQKQEPLGSDSEGVNCLAYDEAIMAQQDRIQQEIAVQNPLVSERLELSVLYKE
YAEDDNIYQQKIKDLHKKYSYIRKTRPDGNCFYRAFGFSHLEALLDDSKELQRFKAVSAK
SKEDLVSQGFTEFTIEDFHNTFMDLIEQVEKQTSVADLLASFNDQSTSDYLVVYLRLLTS
GYLQRESKFFEHFIEGGRTVKEFCQQEVEPMCKESDHIHIIALAQALSVSIQVEYMDRGE
GGTTNPHVFPEGSEPKVYLLYRPGHYDILYK
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggaggaacctcagcagcagaagcaggagccgctgggcagcgattccgaaggt
gttaactgtctagcctatgatgaagccattatggctcagcaagaccggattcagcaagag
attgctgtgcagaatcctctggtgtcagagcgactggaactctcagttctgtataaggag
tatgctgaggatgacaacatttaccaacagaagatcaaggacctccacaaaaagtactcc
tacatacggaagaccaggcccgacgggaactgcttctatcgagcgtttggcttctcccac
ttggaggcactgctcgatgacagcaaggaactgcagcggttcaaagccgtgtctgccaag
agtaaagaggacctggtgtcccagggcttcactgaattcacaatcgaggacttccacaac
acattcatggaccttatcgagcaggtggagaagcagacctcagtagctgacctgctggcc
tccttcaacgaccagagcacctcagactaccttgtggtctacctgcgactgctcacctca
ggctacctgcagcgggagagcaagttcttcgagcacttcatagagggtggccggactgtt
aaggagttctgccagcaggaggtggaacccatgtgcaaggagagcgaccacatccacatc
atcgccctggcccaggccctcagtgtgtccatccaggtggagtacatggaccgcggcgag
ggcggcaccaccaatccacacgtcttccccgagggctctgagcccaaggtctacctgctc
taccgacctggacactacgatatcctctacaaatga

DBGET integrated database retrieval system