KEGG   Rattus norvegicus (rat): 29373Help
Entry
29373             CDS       T01003                                 

Gene name
Bmp2
Definition
(RefSeq) bone morphogenetic protein 2
  KO
K21283  bone morphogenetic protein 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04350  TGF-beta signaling pathway
rno04390  Hippo signaling pathway
rno05200  Pathways in cancer
rno05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    29373 (Bmp2)
   04390 Hippo signaling pathway
    29373 (Bmp2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    29373 (Bmp2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    29373 (Bmp2)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    29373 (Bmp2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    29373 (Bmp2)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    29373 (Bmp2)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   29373 (Bmp2)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate/Haparin
  Morphogens
   29373 (Bmp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-GeneID: 29373
NCBI-ProteinID: NP_058874
RGD: 2211
Ensembl: ENSRNOG00000021276
UniProt: P49001
Position
3q36
AA seq 393 aa AA seqDB search
MVAGTRCLLVLLLPQVLLGGAAGLIPELGRKKFAGASRPLSRPSEDVLSEFELRLLSMFG
LKQRPTPSKDVVVPPYMLDLYRRHSGQPGALAPDHRLERAASRANTVLSFHHEEAIEELS
EMSGKTSRRFFFNLSSVPTDEFLTSAELQIFREQMQEALGNSSFQHRINIYEIIKPATAS
SKFPVTRLLDTRLVTQNTSQWESFDVTPAVMRWTAQGHTNHGFVVEVAHLEEKPGVSKRH
VRISRSLHQDEHSWSQVRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRLKSSCKRHPLYV
DFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNSKIPKACCVP
TELSAISMLYLDENEKVVLKNYQDMVVEGCGCR
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggtggccgggacccgctgtcttctagtgttgctgcttccccaggtcctcctgggcggc
gcggccggcctcattccggagctgggccgcaagaagttcgccggggcatcgcgcccctta
tcccggccttcggaggacgtcctcagcgagtttgagttgaggctgctcagcatgtttggc
ctgaagcagagacccacccccagcaaggacgtcgtggtgcccccctatatgctcgacctg
taccgccggcactcgggccagccaggagcgctcgccccagaccaccggctggagagggca
gccagccgcgccaacaccgtgctcagcttccatcacgaagaagccatcgaggaactttca
gaaatgagtgggaaaacttcccgacgcttcttcttcaatttaagttctgtccctactgat
gagtttctcacatctgcagagctccagatttttcgggaacaaatgcaggaagctttggga
aatagtagtttccagcaccgaattaatatttatgaaattataaagcctgccacagccagc
tcaaaatttcctgtgaccagactattggacaccaggttagtgactcagaacacaagtcag
tgggagagctttgatgtcaccccggctgtgatgcgatggacagcacagggacacaccaac
catgggtttgtggtggaagtggcccacttagaggagaagccaggtgtctccaagagacat
gtgaggattagcaggtctttgcaccaagatgaacacagctggtctcaggtaagaccactg
ctagtgacttttggccacgacggtaaaggacatccactccacaaacgagaaaagcgtcaa
gccaaacacaaacagcggaagcgtcttaagtccagctgcaaaaggcaccctttgtatgtg
gacttcagtgatgtggggtggaatgactggatcgtggcccctccaggctatcatgccttt
tactgccatggggaatgtccttttcccctggctgatcacctgaactccaccaaccatgcc
atagtgcagactctggtaaactctgtgaattccaaaatccctaaggcatgctgtgtcccc
actgagcttagcgcaatctccatgttgtacctagatgaaaacgaaaaggttgtgctaaaa
aactatcaggacatggttgtggagggttgcgggtgtcgctag

DBGET integrated database retrieval system