KEGG   Rattus norvegicus (rat): 293738Help
Entry
293738            CDS       T01003                                 

Gene name
Ccdc86
Definition
(RefSeq) coiled-coil domain containing 86
  KO
K14822  rRNA-processing protein CGR1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:rno03009]
    293738 (Ccdc86)
Ribosome biogenesis [BR:rno03009]
 Eukaryotic Type
  Pre-60S particles
   Other pre-60S particles
    293738 (Ccdc86)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cgr1
Motif
Other DBs
NCBI-GeneID: 293738
NCBI-ProteinID: NP_001006975
RGD: 1359280
Ensembl: ENSRNOG00000020925
UniProt: Q5XIB5
Position
1q43
AA seq 341 aa AA seqDB search
MGTPLRRSRRLEGLNPLSLENLPDPEVSRAKRALVDFKSNPEETRELESPRVPPLDLVSP
QPQPETSPESPCPKQDAGFGSPQRQPEPHPGSLQLHQDLGLDSPAGQTESNPESPQREQS
SKLSPTQDSEVAHAKEEVIPRSPEPCPGQQAPGPEPSQPAQELAFQAPSSPERQLEPSKL
PPAGESVTGSLDLKKRVIASPQAPASKKLKEELPVIPKGKPKSGRVWKDRSKKRFSQMVQ
DKPLRTSWQRKMKERQERKLAKDFARHLEEEKQRRRQEKKERRAENLRRRLENERKAEIV
QVIRNPAKLKKAKKKQLRSIQKRDTLALLQKQPPQRPVAKV
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgggtacgccgctgaggcgcagccggcggctggaaggcctaaaccctctgtctctggag
aaccttcctgaccccgaagtctctcgggccaaacgggctcttgtagatttcaagtcgaac
ccagaagaaacaagagagctcgagtctccgagagttccgccactggaccttgtgtctccc
caacctcagccggagactagccccgaatcaccctgtcctaaacaggatgcaggctttggg
tccccacaaaggcaaccagagcctcaccctgggtcccttcaacttcatcaagatctgggc
ctggattcacctgcaggacagacagagtcgaatccggaatccccgcaacgagagcagtca
tccaaattatctcccacacaggactctgaggtagcccacgctaaggaggaggtgatccca
agatctcccgagccttgcccgggtcagcaagcaccgggtcccgagccctcccagccagca
caggagctggcattccaggcacctagctccccagagcgccagctggagccaagcaagcta
cctccggctggagagtcagtgaccggaagtctcgacctaaagaagcgagttatagcttct
ccccaggccccagcgtccaagaaactgaaggaggagcttcctgtaattccgaaggggaag
cccaaatccgggcgtgtgtggaaagaccgctccaagaagaggttctcccagatggttcag
gacaagcccctgcgtacctcctggcagaggaagatgaaggagcgacaggagaggaagctg
gctaaggacttcgcccggcacctggaggaggagaaacagaggcgccggcaggagaagaaa
gaacgccgagctgagaacctcagacgccgtctagaaaacgaacgcaaagctgagattgtc
caagtgatccggaaccctgccaagctcaagaaagcaaagaagaagcagttgcgctccatt
caaaagagagacaccctggccttgctccagaaacagccaccccagaggcctgtagccaag
gtctga

DBGET integrated database retrieval system