KEGG   Rattus norvegicus (rat): 293743Help
Entry
293743            CDS       T01003                                 

Gene name
Ms4a14, Sp3111
Definition
(RefSeq) membrane spanning 4-domains A14
  KO
K22192  membrane-spanning 4-domains subfamily A member 14
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    293743 (Ms4a14)
Transporters [BR:rno02000]
 Other Transporters
  Pores ion channels [TC:1]
   293743 (Ms4a14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CD20 Acyl_transf_3
Motif
Other DBs
NCBI-GeneID: 293743
NCBI-ProteinID: NP_851596
RGD: 727900
Ensembl: ENSRNOG00000025805
UniProt: Q80WF0
Position
1q43
AA seq 1139 aa AA seqDB search
MEAPSEEKRRNHVIIIDPDETVLTAYPYRPHSSLLDFLKGEPKLLGAIQILLSLVIIGLG
VIVTLNFMFSSKKVPLVILSGYPFWGAVIFFLTGFVTKSHDKQRQILKQDITVMNIFSSL
TALAGIALILFSFTQHHKFCHIPSLDGPCVVGKTLLLGILSILLIITIVEFSISVTIVSL
RSRCWTSPREAVFFFPSESPLNIEHPTPEGNNTLQFEFQEKSSKDKTVSSIKSVFLGGYA
FFKLRVSRNPSAPKTIPQKSDKGTSSMHVPPVEQEAIPPLSPEQEAKLNTLPLSLKPHSS
ENTPQKDSRTDHLIDEDLSSIIRQTSDMQSNVLDYENASVKGLKTPSSHNFFHFSPENLS
SQSLVASLSTQVLQSKQPSLHISESYDLASEDFLSENIPSQDNQDQDIPSPYTPPQDMQF
QVILAQDITSQETPHREPSYQDTLTKDASPQETPNQYILTKEIPSQETPFQGNPPQGTPS
QGTLSQGTPPKGTPSQGTLPKGTSSQGTLSQGTPSQGTLPQGTPSEGTPIQGTPSEGTLI
QGTPFQGTPSAVTLSQGTPPQGTPSAGTLSQGTLPQGTPSQGTLPQGTPSQGTLPQGTPS
QGTLSQGTPSQGTPPQGTPPQGTPSEGTPFQGTPTQGTPSKELSFQHSLTKDTLSQETPY
QETPFQDTLTQNTPSQDIQPEEILSQEISSQDTPFQITPSQNIKYEDILSQDKISQNTQT
QNIVPQMLNTGVQIQQHPEIFYKDIRTEVMEMTEEWQSNQDKKPTRRLSLSLPGKRGQFY
PKRYSLDLQVKTEKPRRYSEDIQSRSTRRKSIDQQIKAWISPKKHTTEKQNAYTQTQEQA
EDQQVKEEEVPVQQSQTEQIKHQKSVEELVSKDKENKDQQCDKEQPPQGQAQVQPAEDQH
PKEEKTQLQNWQGGQQVLIKRSPMQLSDNWDSQSHQYTESSCSFWSTPSWQPISQRSQDW
VSQGWRNKDWKAQEWQFAVQPSLDWESQELLERESLRQRALYRQIQPHTTIIQQTPDHQL
RNFIFQVGLRQDTRQQDSESGVLIEDVSEDDAQSGDRDPGDTEDTCQKPTDQRSEDLRPD
NYPASFQSLVPYTYVTCLSNIASEQEVQNNTPYSGSSKDLNATSSSSYQRDQQQYEDSD
NT seq 3420 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgccatctgaggagaagagaaggaaccatgtcatcattatagacccagacgaa
actgtcttgactgcctatccatatagacctcatagctctctgctcgattttcttaagggg
gagccaaaacttttaggggccatccaaattcttctttctctggtcattataggtcttgga
gttatagtaacacttaatttcatgttttcatccaaaaaagttcctcttgtgatcctctca
ggatatccattctggggagcagttattttttttctgacaggatttgtcacaaagtcccat
gataaacaaagacaaattctgaagcaagacatcacggtcatgaacatcttcagctcgttg
actgcattagctgggattgccttgatcctcttcagctttacacagcatcacaaattctgc
catataccctcccttgacggaccgtgtgtcgtgggcaaaacacttctccttggaattttg
tcaatcttattaatcatcaccatagtagagttcagcatctctgtgactattgtatcctta
agaagcagatgttggaccagtccaagagaggctgtgttcttctttccttcagaaagtcct
ctaaatattgaacatcctaccccagaaggaaataatacattacaatttgagtttcaagaa
aaatcttccaaggataagacagtttcaagcataaaaagtgttttcttaggaggttatgct
ttcttcaagttaagagtctcaagaaatccttcagctcccaaaactatcccacagaaaagc
gataaaggaacgtcttctatgcatgttcctccagtggaacaggaggctattcctccactc
tccccagagcaagaagccaaattgaatactctacctctctcattaaaaccacactcttca
gaaaatacccctcagaaagactctagaactgatcacctgattgatgaggacctatcatct
attatacgccaaacttctgatatgcaatccaatgtgcttgactatgaaaatgcgtcagtc
aaaggtcttaaaactccttcttcacataatttcttccatttttcacctgaaaatttgtca
tcccaatcattagtggcatctctgtcaacacaagtcttacaatctaaacagccatcactc
catatttcagagtcatatgatctggcatctgaagattttctgtctgaaaacatcccatct
caagacaaccaagaccaagacatcccttctccatacactccaccccaagacatgcaattc
caagttatactagctcaagacataacatcccaagagactccacaccgagagccatcgtac
caagacacactaactaaagatgcatcacctcaagagactccaaaccaatatatattgaca
aaagaaataccatcgcaggagactccattccaaggaaatccaccccaaggaactccatca
caagggactctatcccaagggactccacccaaggggactccatcccaagggactctgccc
aaggggacttcatctcaagggactctatcccaagggactccatctcaagggactctaccc
caagggactccatctgaagggaccccaatccaagggactccatctgaaggcaccctaatc
caagggactccattccaagggactccatctgcagtgactctatcccaagggactccacct
caagggactccatctgcagggactctatcccaagggactctacctcaagggactccatct
caagggactctacctcaagggactccatctcaagggactctaccccaagggactccatct
caagggactctatcccaagggactccatctcaaggcactccaccccaagggactccacct
caagggactccatctgaagggactccattccaagggactccaacccaaggaactccatcc
aaagagctatcattccaacattcactaactaaagacacattatctcaagagactccatac
caagaaactccattccaagatacactaactcaaaatacaccatcccaagacatccagcct
gaagagattctgtcacaagagatttcctcccaagatactccattccaaattactccatcc
cagaatataaaatacgaagatatactatctcaagacaaaatatcccaaaacactcaaacc
caaaatatagtacctcaaatgctaaacactggagttcaaatccagcaacatccagaaata
ttttataaggacattcgaacagaagtcatggagatgactgaagaatggcagtctaatcag
gacaagaaacccacgagaagactttccttatccttgccaggcaaacgtgggcaattctat
cccaagagatattctttggacctgcaagtcaaaactgagaaaccaaggagatactctgag
gacatacaaagtagaagtacaagacggaaatccatagatcagcaaatcaaagcctggata
tccccaaagaaacataccacagagaaacaaaatgcatatacccaaacccaagagcaagct
gaagatcagcaggtcaaagaggaggaagtcccagtacaacaatcccaaactgagcaaatc
aaacaccaaaaatctgtagaggagctagtatcaaaagacaaagagaataaagatcagcag
tgtgataaagagcaacctccacaagggcaagctcaagttcaaccagctgaagaccagcat
cccaaagaggaaaaaacccagctccaaaattggcagggaggacaacaagtactaataaag
agatccccaatgcagttgagtgataactgggactcccaaagccatcaatacacagaaagt
tcatgctccttctggtcaactccatcctggcagcctattagccagagatcccaagactgg
gtaagccaaggttggagaaacaaagattggaaagcacaagaatggcagtttgcagtgcag
ccttccctagactgggaatcccaagagctattggagagagaatccttaaggcaaagggca
ctataccgacaaatccaaccccacaccaccataattcagcaaaccccagatcatcaattg
cgaaactttatatttcaagtaggtctgcgtcaagatactagacaacaagactctgaatct
ggtgttttaatagaagatgtgtctgaagatgatgctcagtcaggagacagagacccagga
gatacagaagatacatgccagaaaccaacagaccagcggtcagaagatctgaggccagat
aattaccctgcgtcttttcagagcctggttccatacacatacgtaacctgtttatccaac
atagcttcagagcaagaggtgcagaacaatacaccctactcaggttcatccaaagatctg
aatgccacttcttcctcctcataccaaagagatcaacagcaatatgaagattcagactaa

DBGET integrated database retrieval system