KEGG   Rattus norvegicus (rat): 29375Help
Entry
29375             CDS       T01003                                 

Gene name
Uncx, Chx4, PHD1, Uncx4.1
Definition
(RefSeq) UNC homeobox
  KO
K09328  homeobox protein Unc-4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    29375 (Uncx)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, Prd
    29375 (Uncx)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain PHM7_cyt
Motif
Other DBs
NCBI-GeneID: 29375
NCBI-ProteinID: NP_058875
RGD: 69361
Ensembl: ENSRNOG00000001284
UniProt: P97830
Position
12q11
AA seq 530 aa AA seqDB search
MMDGRLLEHPHAQFGGSLGGVVGFPYPLGHHHVYELAGHQLQSAAAAAAAASVPFSIDGL
LSGSCAAAAASVVNPTPLLPAACGVAGESQPFKLADSGDPDKESPGCKRRRTRTNFTGWQ
LEELEKAFNESHYPDVFMREALAVRLDLVESRVQVWFQNRRAKWRKKENTKKGPGRPAHN
SHPTTCSGEPMDPEEIARKELEKMEKKKRKHEKKLLKSQSRHLHSPGGLSLHSAPSSDSD
SGGGGLSPEPPEPPPPTASAKGPGAHGSGIAGSAPVPPGEPPAPGTCDPAFYPSQRSGAG
SQPRLGRPADKDTVPCGPGAASTAGLPKASPFSVESLLSDSPPRRKATPANTAATAGLDF
TPGLPCAPRTLIGKGHFLLYPITQPLGFLVPQAALKGGAGPELVPKDAPPAPPAPPAPPA
QASFGAFPGPVGAADPAFARRSPEVVASPGPPAPASFRGLAAAAAESGAGDCADAGTVCP
AAPPPPPLETSPGPGPRAPSPPGEPATCGAAEPGAATGSSPPEGEEVDMD
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgatggacggtcgcctcctggagcacccgcatgcccagttcgggggctcgctgggcggc
gtggtgggcttcccctacccgctgggccaccaccacgtgtacgagctggccggtcaccag
ctgcagtcggccgccgccgccgccgccgcggcctcggtgcccttctccatcgacggcctg
ctcagcggctcgtgcgctgcagcagccgcctcggtggtcaaccccacgccgctgctgccg
gccgcctgcggggtggcgggcgaaagccagcccttcaagcttgcagactcgggggatcca
gacaaggagagccccggctgcaaacggagacgcacccgcactaacttcaccggctggcag
ctggaggagctggagaaggcattcaatgagagccactacccggacgtgttcatgcgcgag
gcgctggccgtgcgcctggacctggtcgagtcccgagttcaggtctggttccaaaatcgc
cgggccaagtggagaaagaaggagaacaccaagaagggcccgggccggccagcccacaac
tcgcacccgaccacgtgcagcggggagcccatggacccggaggagatcgctcgcaaggaa
ctggagaagatggagaagaagaaacgcaaacacgagaagaaactgctcaagagtcagagc
cgccacctgcactcgcccggtggcctgtccctgcacagcgcgcctagctcagacagcgac
agcggtggcggaggcctgtctccagagccacccgagcctccaccgccgaccgcctcggcc
aagggccctggagcgcacggctctggcatcgcgggctccgctccggtacctcctggcgag
ccacccgcgcctggcacctgcgaccccgccttctacccgagccaaagaagcggcgccggc
tcgcagccgcggctaggccgcccggcggacaaggacacggtcccttgcgggcccggagcg
gcgtcgactgcaggcctgcctaaggctagcccgttcagcgtggagagcctgctgtccgac
tcgccaccgcgccgcaaagccaccccagccaacactgcggccacagcggggttggacttc
acgccggggctgccgtgcgcacctcggaccctgattggcaagggccacttcttgctctac
cccatcacgcagcccctcggcttcctggtgccacaggcagcgctcaagggaggagcaggc
cctgagttggtgcccaaggacgcgccccccgcgccgcccgcgccgcccgcaccgcccgcg
caggccagcttcggggccttccccggacctgttggcgctgcggacccggctttcgcccgt
cgcagccctgaggttgttgcctcccctgggccaccggctcccgcttctttccggggccta
gcagcggcggcagcggagagcggtgccggggactgcgcggacgcggggaccgtctgcccc
gcggccccgccgcccccgcccctcgaaacgtcgcccggtccgggccccagagcccccagt
ccacccggagagccagccacttgcggcgccgctgagccgggcgctgctacgggatccagc
ccgcccgagggcgaggaggtggacatggactga

DBGET integrated database retrieval system