KEGG   Rattus norvegicus (rat): 293754
Entry
293754            CDS       T01003                                 

Gene name
Mrpl16
Definition
(RefSeq) mitochondrial ribosomal protein L16
  KO
K02878  large subunit ribosomal protein L16
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    293754 (Mrpl16)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rno03011]
    293754 (Mrpl16)
Ribosome [BR:rno03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    293754 (Mrpl16)
  Bacteria
    293754 (Mrpl16)
SSDB
Motif
Pfam: Ribosomal_L16
Other DBs
NCBI-GeneID: 293754
NCBI-ProteinID: NP_001009647
RGD: 735195
Ensembl: ENSRNOG00000021005
UniProt: Q5M818
Position
1q43
AA seq 251 aa
MWRLLTRAPAPLWRMHFSDTWAALPTSAGLKTLLPVPTFENVSIPERSKLKFVERVPLVP
KVRREPKNLKDIRGPSAEATDFTEGNFAILALGGGYLHWGHFEMMRLTINRFMDPKNMFA
IWRVPAPFKPITRKGVGQRMGGGKGAIDHYVTPVKTGCLIVEMGGRCEFEEVKRVLNQVA
HKLPFPAKAVSRKTLEKMHQNQKERELNNQNPWTFERIATANMFGIRKFLSPYDLTQKGR
YWGKFYMPKRV
NT seq 756 nt   +upstreamnt  +downstreamnt
atgtggaggctactgacgcgcgcgcccgcgccgctctggcggatgcacttttcagatact
tgggcagcccttcccaccagtgctggtctgaagacgctcctcccagttccaacttttgaa
aatgtctccatccctgaaagatccaaacttaaatttgttgaaagagtcccacttgtgcca
aaagtaaggagagaacctaaaaatctgaaggacatacgagggccttcagctgaagccact
gacttcacagaaggcaattttgcaattttggcacttggaggtggttatcttcactggggc
cattttgaaatgatgcgcttgacaatcaatcgatttatggatcccaagaacatgtttgcc
atatggcgagtgccagcccctttcaagcccatcactcgaaaaggtgttgggcagcgcatg
gggggaggtaaaggtgccattgatcactatgtgacacctgtgaagactggatgcctcata
gtagagatgggtggacgctgtgaatttgaagaggtaaagcgtgtcctgaaccaggttgcc
cacaagttgccctttccagcaaaggccgtgagccgtaagactctagaaaagatgcaccaa
aatcaaaaagaaagagaacttaataaccagaatccctggacctttgagcgcatagccact
gcgaacatgtttggcatacggaaattcctgagcccatatgacctgactcagaaagggcga
tattggggcaaattctacatgcccaagcgcgtgtag

DBGET integrated database retrieval system