KEGG   Rattus norvegicus (rat): 29376Help
Entry
29376             CDS       T01003                                 

Gene name
Irs2, 4PS, IRS-2
Definition
(RefSeq) insulin receptor substrate 2
  KO
K07187  insulin receptor substrate 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04068  FoxO signaling pathway
rno04140  Autophagy - animal
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04910  Insulin signaling pathway
rno04920  Adipocytokine signaling pathway
rno04923  Regulation of lipolysis in adipocytes
rno04930  Type II diabetes mellitus
rno04931  Insulin resistance
rno04932  Non-alcoholic fatty liver disease (NAFLD)
rno05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    29376 (Irs2)
   04022 cGMP-PKG signaling pathway
    29376 (Irs2)
   04152 AMPK signaling pathway
    29376 (Irs2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    29376 (Irs2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    29376 (Irs2)
   04923 Regulation of lipolysis in adipocytes
    29376 (Irs2)
   04920 Adipocytokine signaling pathway
    29376 (Irs2)
  09149 Aging
   04211 Longevity regulating pathway
    29376 (Irs2)
   04213 Longevity regulating pathway - multiple species
    29376 (Irs2)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    29376 (Irs2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    29376 (Irs2)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    29376 (Irs2)
   04931 Insulin resistance
    29376 (Irs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRS PH PH_11
Motif
Other DBs
NCBI-GeneID: 29376
NCBI-ProteinID: NP_001162104
RGD: 69316
Ensembl: ENSRNOG00000023509
UniProt: F1MAL5
Position
16q12.5
AA seq 1327 aa AA seqDB search
MASAPLPGPPASAGGDGPNLNNNNNNNNNHSVRKCGYLRKQKHGHKRFFVLRGPGTGGEE
AAAAGGSPPQPPRLEYYESEKKWKSKAGAPKRVIALDCCLNINKRADAKHKYLIALYTKD
EYFAVAAENEQEQEGWYRALTDLVSEGRSGDGGSGTTGGSCSASLPGALGGSAGAAGCDD
NYGLVTPATAVYREVWQVNLKPKGLGQSKNLTGVYRLCLSARTIGFVKLNCEQPSVTLQL
MNIRRCGHSDSFFFIEVGRSAVTGPGELWMQADDSVVAQNIHETILEAMKALKELFEFRP
RSKSQSSGSSATHPISVPGARRHHHLVNLPPSQTGLVRRSRTDSLAATPPAAKCTSCRVR
TASEGDGGAAGGAGTAGGRPMSVAGSPLSPGPVRAPLSRSHTLSAGCGGRPSKVALAPAG
GALQHSRSMSMPVAHSPPAATSPGSLSSSSGHGSGSYPLPPGSHPHLPHPLHHPQCQRPS
SGSASASGSPSDPGFMSLDEYGSSPGDLRAFSSHRSNTPESIAETPPARDGSGGELYGYM
SMDRPLSHCGRPYRRVSGDGAQDLDRGLRKRTYSLTTPARQRQVPQPSSASLDEYTLMRA
TFSGSSGRLCPSLPASSPKVAYNPYPEDYGDIEIGSHKSSSSNLGADDGYMPMTPGAALR
SGGPNSCKSDDYMPMSPTSVSAPKQILQPRSAAALPPSGAAVPAPPSGAGRTFPVNGGGY
KASSPAESSPEDSGYMRMWCGSKLSMENPDPKLLPNGDYLNMSPSEAGTAGTPPDFFSAA
LRPGGEALKGVPGHCYSSLPRSYKAPCTCGGGDNDQYVLMSSPVGRILEEERLEPQATPG
AGTFGAAGGSHTQPHHSAVPSSMRPSGIVGRPEGFLGQRCRAVRPTRLSLEGLQTLPSMQ
EYPLPTEPKSPGEYINIDFGEGGTRLSPPAPPLLASAASSSSLLSASSPASSLGSGTPGT
SSDSRQRSPLSDYMNLDFSSPKSPKPSTRSGDTVGSIDGLLSPEASSPYPPLPPRPSASP
SSLQQPLPPAPGDLYRLPPATAATSQGPTAGSSMSSEPGDNGDYTEMAFGVAATPPQPIA
APPKPEGARVTSPTSGLKRLSLMDQVSGVEAFLQVSQPPDPHRGAKVIRADPQGGRRRHS
SETFSSTTTVTPVSPSFAHNSKRHNSASVENVSLRKSSEGNSILGGSDEPSTSPGQAQPS
AGVPPAPQARPWNPGQPGALIGCPGGSSSPMRRETSVGFQNGLNYIAIDVRGEQGSLAQS
QPQHPQPGDKNSWGRTRSLGGLLGTVGGSGTSGVCGGPGTGALPSASTYASIDFLSHHLK
EATVVKE
NT seq 3984 nt NT seq  +upstreamnt  +downstreamnt
atggctagcgcgcccctgcctgggccccccgcgtcggcgggcggggacggcccgaacctc
aataacaacaacaacaacaacaacaaccacagcgtgcgcaagtgcggctacctgcgcaag
cagaagcacggccacaagcgcttcttcgtgctgcgcggcccgggcaccggcggcgaggag
gcagccgcggctggggggtcgccgccgcagcctccgcggctggagtactatgagagcgag
aagaagtggaagagcaaggcgggcgcgccgaagcgagtgatcgcgctcgactgctgtctg
aacatcaacaagcgcgcggacgccaagcacaagtacctgatcgccctctacaccaaggac
gagtacttcgccgtagcggcggagaacgagcaggagcaggagggctggtaccgcgcactc
accgacttggtcagcgaaggccgctctggcgatgggggctccggcaccacgggcggctct
tgcagcgcctctctcccgggggccctgggcggctcggcgggcgccgctggctgcgatgac
aactacgggctcgtgacgcccgccacggcagtctaccgcgaggtgtggcaggtgaacctg
aagcctaagggactgggccagagcaagaacctgaccggtgtataccgcctatgcctgtct
gcgcgcaccatcggcttcgtgaagctcaattgcgaacagccgtcggtgacgctgcagctt
atgaacattcgccgctgcggccactcggacagcttcttcttcatcgaggtgggccgttca
gccgtcaccggtcccggcgagctgtggatgcaagccgatgactcggtggtggcgcagaac
atccatgagaccatcctggaggccatgaaggcactcaaggagctcttcgagttccggcct
cgcagcaagagtcagtcgtctgggtcgtctgccacgcaccccatcagcgtaccgggcgcg
cgccgccaccaccacctagtcaacctaccccctagccagacgggcctggtgcgccgctct
cgcactgatagcctggcggccaccccgccagcagccaagtgcacttcgtgccgggttcgt
acagccagcgagggtgacggcggcgcggcaggcggagccgggacggcaggaggcaggccg
atgtcggtggcagggagccccctgagtcccgggccggtgcgcgcgccccttagccgctcg
cacaccctgagcgccggctgcggaggccgcccgagcaaagtggctctggcgccggcaggg
ggagccctacaacacagccgctccatgtccatgcccgtggcgcactcgccgcctgcagcc
accagcccaggcagcctgtcctccagcagtgggcatggctcaggctcctacccgctgcct
cctggttcccacccgcacctgcctcatccgctccatcacccccaatgccaacgtccgtcc
agcggaagtgcctccgcctcgggctcccccagcgacccgggtttcatgtcccttgacgag
tatggctccagccctggtgacctgagagccttcagtagccacaggagcaacacacctgag
tccatcgcggagaccccgccagccagggacggcagtgggggcgagctctatgggtatatg
agcatggataggcccctgagccactgtggccgcccttaccgtagggtctctggggatggg
gcccaggatctggacagaggactgaggaagaggacttactccctaaccacgcctgcccgg
cagcggcaggttcctcagccttcctctgcctctctagacgaatacactctcatgcgggcc
accttctctggcagttcaggtcgcctctgcccatccctccctgcgtcctctcccaaagtg
gcctacaacccttacccagaggactatggagacattgagattggttctcacaagagttcc
agcagtaacctgggggcagatgatggctacatgcccatgacccctggggcagccctcagg
agtggtggccccaatagctgcaagagcgatgactacatgcccatgagccccaccagcgtg
tctgcccctaagcagatcctgcaaccacgttcggcagcggccttgcccccctctggagca
gccgtgccagcacccccttcaggggcgggcaggactttcccagtgaacggaggcggctac
aaagccagctccccagcggagagctccccagaagatagcgggtacatgcgaatgtggtgt
ggctccaagctgtccatggagaacccagaccctaagctgctccccaatggggactacctc
aacatgtcccccagtgaggcaggcaccgcagggaccccacctgacttcttctcagcagct
ttgcgtccaggcggtgaggccctcaaaggcgtccctggccactgctacagctctttgccc
cgctcttacaaggctccctgtacttgcggtggtggagacaacgaccagtacgtgctcatg
agctcccctgtgggtcggattttggaagaggagagactggagccccaggccaccccaggg
gctggcacatttggggcagctggtggtagtcatacccagcctcatcactcagcagtgcct
tcctccatgagaccaagtggcatcgttggccgacctgagggcttcctgggccagcgctgt
cgggcagtgcggcccacacgcctttcgctagagggactgcagacccttcccagcatgcaa
gagtaccctctacccactgagcccaagagccctggcgagtacatcaacattgactttggt
gaagggggtacccgtctgtctccgcctgctcccccactactggcatcagcggcctcctcc
tcttcactgctctcagccagtagtcctgcttcatccctgggttcaggtaccccaggcacc
agcagtgacagccggcagcgctctccgctctctgactatatgaacctggacttcagttct
cccaagtcccctaagcctagcacccgcagtggggacacagtgggctccatcgatggcctt
ctctctccagaagcctcatccccatacccaccgctgcccccgcgtccttctgcttcccct
tcctccttacagcagcctctgccacctgccccaggagacctataccgcctgcctccagca
acagctgccacatcccagggtcccactgctggctcctcaatgtcctctgagcctggggat
aatggtgactataccgagatggcctttggtgtggctgctaccccgccacaacctattgcg
gcacccccgaagccagaaggtgcccgagtgaccagtcccacatcaggcttgaagcggcta
agtctcatggatcaggtatctggggtagaggccttccttcaagtcagccagccccctgat
ccccaccggggcgctaaggtcatccgtgcagacccgcaggggggacgtcgtcgccacagt
tcagagaccttctcctctaccaccactgtcaccccagtgtccccatcctttgctcacaat
tccaagcgccacaattcggcctctgtggaaaacgtctctctcaggaaaagcagtgaaggc
aacagcatcctgggaggaagtgatgagccatccacatccccaggacaggcacagccctcg
gcaggtgtgcccccagcgccacaggctaggccatggaaccccggtcagcctggagctttg
attggctgtcctggaggcagcagttctcccatgcgcagagagacctccgtgggtttccag
aacggcctcaactatatcgccatcgatgtgagaggtgagcaggggtccttggcgcagtct
cagcctcagcatccacagccaggagacaagaactcctggggccggacccgtagccttggg
gggctcctcggtaccgttggaggctctggcaccagtggagtgtgtgggggtccaggcact
ggagccttaccctctgccagcacctacgcaagcatcgacttcttgtcccatcacttgaaa
gaagccaccgtggtgaaagagtaa

DBGET integrated database retrieval system