KEGG   Rattus norvegicus (rat): 293793Help
Entry
293793            CDS       T01003                                 

Gene name
Olr352
Definition
(RefSeq) olfactory receptor 352
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    293793 (Olr352)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    293793 (Olr352)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    293793 (Olr352)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 293793
NCBI-ProteinID: NP_001000256
RGD: 1332654
Ensembl: ENSRNOG00000054590
UniProt: A0A0G2K034
Position
1q43
AA seq 307 aa AA seqDB search
MENVTEMTWFVLLGLNDDPKLQLPLFITFFLIYIITLMGNLGMILLILLDSRLHTPMYIF
LSNLSLVDFCYSSTVTPKVMAGFLTGDKIMSYNACASQIFFFATFANVESYLLVSMAYDR
YAAVCKPLRYATTMTTGVCVGLVIVCYICGFLNASIYTVNALSLSFYKLNVVHHFFCDIP
AIMIVAYSDRHVNDLVLISVASFNIFFALILILISYMLIFTNILKLRSAAGYRKALSTCT
SHFIAVSIFYGTLTFMYLQPSSSHSMDTDKIASVFYTMVIPMLNPLVYSVRNKEVKNAFT
KIVLRSK
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggagaatgtgacagaaatgacatggtttgtccttctgggactcaacgatgacccaaaa
ctccagcttcctctcttcatcaccttcttcctcatctacatcatcactctgatggggaac
ctgggaatgatcctgctgattctcctcgactctcggctccacacccccatgtacattttt
ctaagtaacctgtccttagtggatttctgttactcttcaacagtcactccaaaggtcatg
gctggatttcttacaggagacaaaatcatgtcttacaatgcttgtgcctctcagatattc
ttttttgcaacctttgccaatgtggaaagctaccttttggtctcaatggcctatgatcgc
tatgcagcagtgtgtaagcctctacgttatgccaccactatgacaacaggtgtgtgtgtg
ggtctagttattgtctgttatatctgtggcttcctgaatgcttccatctatactgtgaat
gcattaagtctctccttttacaaattaaatgtggtccatcattttttctgtgacattcca
gcaattatgatagtagcttattctgatcggcatgttaatgacctggttcttatttcagta
gccagcttcaatatcttttttgctcttatactcatcttaatatcctatatgttaattttt
actaatatactaaagctgcgttcagctgccggatatcggaaagctctctccacttgtacc
tcacacttcatagctgtctcaattttctatgggacactaacattcatgtacttgcagcca
agctccagtcattctatggacactgacaaaattgcatctgtgttctacacaatggtcatc
cccatgttgaaccctctggtctacagtgtaaggaacaaagaagtgaagaatgcatttaca
aagattgtattgaggtcaaaataa

DBGET integrated database retrieval system