KEGG   Rattus norvegicus (rat): 29381
Entry
29381             CDS       T01003                                 

Gene name
Acvr1b, Skr2
Definition
(RefSeq) activin A receptor type 1B
  KO
K13567  activin receptor type-1B [EC:2.7.11.30]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04350  TGF-beta signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    29381 (Acvr1b)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    29381 (Acvr1b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    29381 (Acvr1b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    29381 (Acvr1b)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     29381 (Acvr1b)
Protein kinases [BR:rno01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   29381 (Acvr1b)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr TGF_beta_GS APH Activin_recp Pkinase_fungal FTA2
Other DBs
NCBI-GeneID: 29381
NCBI-ProteinID: NP_954700
RGD: 735207
Ensembl: ENSRNOG00000006934
Vega: OTTRNOG00000001626
UniProt: P80202
Position
7q36
AA seq 505 aa
MAESAGASSFFPLVVLLLAGSGGSGPRGIQALLCACTSCLQTNYTCETDGACMVSIFNLD
GMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYIDFCNKIDLRVPSGHLKEPEHPS
MWGPVELVGIIAGPVFLLFLIIIIVFLVINYHQRVYHNRQRLDMEDPSCEMCLSKDKTLQ
DLVYDLSTSGSGSGLPLFVQRTVARTIVLQEIIGKGRFGEVWRGRWRGGDVAVKIFSSRE
ERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVT
IEGMIKLALSAASGLAHLHMEIVGTQGKPGIAHRDLKSKNILVKKNGMCAIADLGLAVRH
DAVTDTIDIAPNQRVGTKRYMAPEVLDETINMKHFDSFKCADIYALGLVYWEIARRCNSG
GVHEEYQLPYYDLVPSDPSIEEMRKVVCDQKLRPNVPNWWQSYEALRVMGKMMRECWYAN
GAARLTALRIKKTLSQLSVQEDVKI
NT seq 1518 nt   +upstreamnt  +downstreamnt
atggcggagtcggccggagcctcctccttcttcccccttgttgtcctcctgctcgccggc
agtggcgggtccgggccccgggggatccaggctctgctgtgtgcatgcaccagctgccta
cagaccaactacacctgcgaaacagatggggcctgcatggtctccatctttaacctggat
ggcatggagcaccacgtacgcacctgcatccccaaggtggagcttgtgcctgctgggaag
cccttctactgcctgagttcagaggacctgcgcaacacgcactgctgctatattgacttc
tgcaacaagattgacctgagggtgcccagtggacacctcaaggagcctgagcacccctcc
atgtggggccctgtggagctggtcggcatcattgccggtcctgtcttcctcctcttcctc
atcatcatcatcgtcttcctggtcatcaactatcatcagcgtgtctaccacaaccgccaa
agactggacatggaggacccctcatgtgagatgtgtctctccaaagacaagacgctccag
gatctcgtctacgatctctccacttcaggatcgggctcagggttacccctttttgtccag
cgcacagtggcccgaaccattgttttacaagagattatcggcaagggccggtttggggaa
gtatggcgtggccgctggaggggtggtgatgtggctgtgaaaatcttctcttcccgtgaa
gagcggtcgtggttccgggaggcagagatctaccagactgtcatgctgcgccatgaaaac
atccttgggtttattgctgctgacaataaagacaatggcacctggacccagctgtggctt
gtctctgactatcacgagcacggctcactgttcgattatctgaaccgctacacagtgacc
attgaggggatgattaaactggccctgtctgcagccagtggtttggcacacctgcatatg
gagattgtgggcactcaggggaagcctggaattgctcatcgagacttgaagtcaaagaac
attctggtgaagaagaatggcatgtgtgccattgcagacctgggcctagctgtccgtcac
gatgctgtcactgacaccatagacattgctccaaatcagagggtgggaaccaaacgatac
atggctcctgaagtacttgacgagaccatcaacatgaagcactttgactccttcaagtgt
gccgatatctacgccctcgggcttgtctattgggagattgctcggaggtgcaattctgga
ggagtccatgaagagtatcaactgccatattatgatttagtgccctctgacccttccatt
gaggaaatgcgaaaggtcgtctgtgaccagaagctacggcccaatgtccccaactggtgg
cagagttatgaggccttgcgagtgatggggaagatgatgcgggagtgctggtacgccaat
ggtgctgcccgcctgacagcgctgcgcatcaagaagactttgtcccagctaagcgtgcag
gaagacgtgaagatttaa

DBGET integrated database retrieval system