KEGG   Rattus norvegicus (rat): 29381
Entry
29381             CDS       T01003                                 

Gene name
Acvr1b
Definition
(RefSeq) activin receptor type-1B precursor
  KO
K13567  activin receptor type-1B [EC:2.7.11.30]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04350  TGF-beta signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    29381 (Acvr1b)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    29381 (Acvr1b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    29381 (Acvr1b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    29381 (Acvr1b)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     29381 (Acvr1b)
Protein kinases [BR:rno01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   29381 (Acvr1b)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr TGF_beta_GS APH Activin_recp Pkinase_fungal FTA2
Other DBs
NCBI-GeneID: 29381
NCBI-ProteinID: NP_954700
RGD: 735207
Ensembl: ENSRNOG00000006934
Vega: OTTRNOG00000001626
UniProt: P80202
Position
7
AA seq 505 aa
MAESAGASSFFPLVVLLLAGSGGSGPRGIQALLCACTSCLQTNYTCETDGACMVSIFNLD
GMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYIDFCNKIDLRVPSGHLKEPEHPS
MWGPVELVGIIAGPVFLLFLIIIIVFLVINYHQRVYHNRQRLDMEDPSCEMCLSKDKTLQ
DLVYDLSTSGSGSGLPLFVQRTVARTIVLQEIIGKGRFGEVWRGRWRGGDVAVKIFSSRE
ERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVT
IEGMIKLALSAASGLAHLHMEIVGTQGKPGIAHRDLKSKNILVKKNGMCAIADLGLAVRH
DAVTDTIDIAPNQRVGTKRYMAPEVLDETINMKHFDSFKCADIYALGLVYWEIARRCNSG
GVHEEYQLPYYDLVPSDPSIEEMRKVVCDQKLRPNVPNWWQSYEALRVMGKMMRECWYAN
GAARLTALRIKKTLSQLSVQEDVKI
NT seq 1518 nt   +upstreamnt  +downstreamnt
atggcggagtcggccggagcctcctccttcttcccccttgttgtcctcctgctcgccggc
agtggcgggtccgggccccgggggatccaggctctgctgtgtgcatgcaccagctgccta
cagaccaactacacctgcgaaacagatggggcctgcatggtctccatctttaacctggat
ggcatggagcaccacgtacgcacctgcatccccaaggtggagcttgtgcctgctgggaag
cccttctactgcctgagttcagaggacctgcgcaacacgcactgctgctatattgacttc
tgcaacaagattgacctgagggtgcccagtggacacctcaaggagcctgagcacccctcc
atgtggggccctgtggagctggtcggcatcattgccggtcctgtcttcctcctcttcctc
atcatcatcatcgtcttcctggtcatcaactatcatcagcgtgtctaccacaaccgccaa
agactggacatggaggacccctcatgtgagatgtgtctctccaaagacaagacgctccag
gatctcgtctacgatctctccacttcaggatcgggctcagggttacccctttttgtccag
cgcacagtggcccgaaccattgttttacaagagattatcggcaagggccggtttggggaa
gtatggcgtggccgctggaggggtggtgatgtggctgtgaaaatcttctcttcccgtgaa
gagcggtcgtggttccgggaggcagagatctaccagactgtcatgctgcgccatgaaaac
atccttgggtttattgctgctgacaataaagacaatggcacctggacccagctgtggctt
gtctctgactatcacgagcacggctcactgttcgattatctgaaccgctacacagtgacc
attgaggggatgattaaactggccctgtctgcagccagtggtttggcacacctgcatatg
gagattgtgggcactcaggggaagcctggaattgctcatcgagacttgaagtcaaagaac
attctggtgaagaagaatggcatgtgtgccattgcagacctgggcctagctgtccgtcac
gatgctgtcactgacaccatagacattgctccaaatcagagggtgggaaccaaacgatac
atggctcctgaagtacttgacgagaccatcaacatgaagcactttgactccttcaagtgt
gccgatatctacgccctcgggcttgtctattgggagattgctcggaggtgcaattctgga
ggagtccatgaagagtatcaactgccatattatgatttagtgccctctgacccttccatt
gaggaaatgcgaaaggtcgtctgtgaccagaagctacggcccaatgtccccaactggtgg
cagagttatgaggccttgcgagtgatggggaagatgatgcgggagtgctggtacgccaat
ggtgctgcccgcctgacagcgctgcgcatcaagaagactttgtcccagctaagcgtgcag
gaagacgtgaagatttaa

KEGG   Rattus norvegicus (rat): 79558
Entry
79558             CDS       T01003                                 

Gene name
Acvr1
Definition
(RefSeq) activin receptor type-1 precursor
  KO
K04675  activin receptor type-1 [EC:2.7.11.30]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04350  TGF-beta signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    79558 (Acvr1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    79558 (Acvr1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    79558 (Acvr1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    79558 (Acvr1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    79558 (Acvr1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     79558 (Acvr1)
Protein kinases [BR:rno01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   79558 (Acvr1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase TGF_beta_GS Activin_recp Pkinase_fungal Haspin_kinase APH FTA2
Other DBs
NCBI-GeneID: 79558
NCBI-ProteinID: NP_077812
RGD: 620200
Ensembl: ENSRNOG00000005033
UniProt: P80201 B3DM96
Position
3
AA seq 509 aa
MVDGAMILSVLMMMALPSPSMEDEEPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSVN
DGFRVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNVTARLPTKGKSFPGSQNF
HLEVGLIILSVVFAVCLFACILGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTL
AELLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSR
DEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTL
DTVSCLRIVLSIASGLAHLHIEIFGTQGKSAIAHRDLKSKNILVKKNGQCCIADLGLAVM
HSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVS
NGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQ
NPSARLTALRIKKTLTKIDNSLDKLKTDC
NT seq 1530 nt   +upstreamnt  +downstreamnt
atggtcgatggagcaatgatcctttctgtgctaatgatgatggctctcccttccccgagt
atggaagatgaggagcccaaggtcaacccgaagctttacatgtgtgtgtgtgagggcctc
tcctgcgggaacgaggaccactgtgagggccagcagtgtttttcctccctgagcgtcaat
gatggcttccgcgtctaccagaagggctgctttcaggtctatgagcaggggaagatgacg
tgtaagaccccgccgtcgcctggccaggctgtggagtgctgccaaggggactggtgcaac
aggaacgtcacggcccggctgcccactaaagggaaatccttccctggatcgcagaacttc
cacctggaagttggccttatcatcctctccgtggtgtttgcggtatgccttttcgcttgc
atccttggcgttgctctcaggaagtttaaaaggcgcaatcaagagcgcctgaaccccaga
gacgtggagtacggtactatcgaagggctcatcaccaccaacgtcggagatagcactcta
gcggaattactagatcactcatgtacatcaggaagtggctccggtcttccttttctggta
cagagaactgtggctcgacagataaccctgttggagtgtgtcgggaagggccggtatgga
gaagtgtggaggggcagctggcaaggcgaaaatgttgctgtgaagatcttctcctcccgt
gatgagaagtcgtggttcagggagacagaattgtacaacacggttatgctgaggcatgag
aatatcttaggtttcattgcttcagacatgacctctagacactccagtacccagctgtgg
ctcattacacattaccacgaaatgggatcgttgtatgactaccttcagctcaccactctg
gacacggttagctgccttcggatcgtgttgtccatagccagcggccttgcacacttgcac
atagagatatttgggacccaggggaagtctgccatcgcccaccgagatctaaagagcaaa
aacatcctcgtgaagaagaacggacagtgctgcatagcagatttgggcctggcagtcatg
cattcccagagcacgaatcagcttgatgtgggaaacaacccccgtgtggggaccaagcgc
tacatggcccctgaagtgcttgatgaaaccatccaagtggattgctttgattcttataag
agggtcgatatttgggcctttggcctcgttctgtgggaagtggccaggaggatggtgagc
aatggtatagtggaagattacaagccaccattctatgatgttgttcccaatgacccaagt
tttgaagatatgaggaaagttgtctgtgtggatcaacagaggccaaacatacctaacaga
tggttctcagacccgacattaacttctctggcgaagctgatgaaagaatgctggtaccag
aacccatccgccagactcacagctctacgtatcaaaaagactttgaccaaaattgataac
tccctagacaaattaaaaactgactgttga

DBGET integrated database retrieval system