KEGG   Rattus norvegicus (rat): 293810
Entry
293810            CDS       T01003                                 

Gene name
Olr377
Definition
(RefSeq) olfactory receptor 377
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    293810 (Olr377)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    293810 (Olr377)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    293810 (Olr377)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 293810
NCBI-ProteinID: NP_001001276
RGD: 1333595
Ensembl: ENSRNOG00000013198
UniProt: D3ZCH0
Position
1q43
AA seq 314 aa
MAGKNYTFVTQFFLTAFTEHPEWGLPLFLLFLSFYLSTLLGNTGMIILIQKNRRLQTPMY
FFLSHLSFVDICYSSVIIPQMLAVLWEHGTTISQVRCAVQFFLFTFFASIDCYLLAIMAY
DRYVAVCQPLLYVTIMTEKACVGLVTGAYVAGFSSGFIRTVTAFTLSFCGSNEINFIFCD
LPPLLKLVCGNSYVQEVVIIVFAIFVMPACIVVISVSYLFIIVAIMQIRSAGGRAKTFST
CTSHLTAVALFFGTLIFMYLRNNTDQFSERDRVVSVFYTVVTPLLNPLIYSLRNKEVKEA
IIKSLRRSKISRGN
NT seq 945 nt   +upstreamnt  +downstreamnt
atggctgggaagaattataccttcgtgactcagttctttctgactgcattcacagaacat
cctgagtgggggctccctctctttcttttatttttgagtttctacctctccacactgctg
gggaatacaggaatgatcattctgatccagaagaaccgcagacttcaaacaccaatgtat
ttcttcctcagtcacctttcctttgtggacatctgctactcctctgtcatcatccctcag
atgcttgctgtgctgtgggaacatggcacaaccatttctcaagttcgctgtgcagttcag
ttcttcctctttactttctttgcttccattgactgctacctcttggcaatcatggcctat
gaccgctatgtggctgtgtgccaaccactgctttatgtcactatcatgacggagaaagcc
tgtgtaggattggtaactggggcatatgtggctggtttttccagtggctttattcgtact
gtcacagccttcactctctctttctgtggaagcaatgagatcaacttcatattctgtgac
ctcccgccactgttaaaactcgtatgtgggaacagttacgtccaggaggtggtgataatt
gtctttgccatttttgtcatgcctgcttgtattgtggttatctctgtatcctatctgttt
atcattgtggctatcatgcagatccgctcagctggaggccgagccaaaactttctctaca
tgcacctcccacctcactgctgtcgctctcttctttggtacccttatcttcatgtacttg
agaaataatacagaccaattctcagagagggaccgagttgtgtctgtgttctatacagtg
gtaaccccattattgaatccactcatctatagcctgagaaataaagaggtaaaagaggcc
attattaaatctctgagaagatcaaagatttcccggggaaactag

DBGET integrated database retrieval system