KEGG   Rattus norvegicus (rat): 293817Help
Entry
293817            CDS       T01003                                 

Gene name
Olr384
Definition
(RefSeq) olfactory receptor 384
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    293817 (Olr384)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    293817 (Olr384)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    293817 (Olr384)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 293817
NCBI-ProteinID: NP_001000263
RGD: 1333930
Ensembl: ENSRNOG00000032117
UniProt: D4ACB1
Position
1q43
AA seq 316 aa AA seqDB search
MAKNNVTTVTEFILMGFNDHPNWEIPLFLVFLSLYLVTILGNLGMVILIHIDVQLHIPMY
FFLSHLSVLDTCYTSVITPQILATLATGKTAISYGHCAAQFFFFTVCAGTECFLLSVMAY
DRYVAISKPLLYTVAMHPRKCWSLVVGAYLCGVSGAILRTTCTFSLSFCENNQINFFFCD
LPPLLKLACSDTANVEIIIVFFGNFVILANALVILISYLLIIKAVMKMKSSGRRAKTFST
CVSHLTAVALLFGTLIFMYIRSGSKKSLEEDKVVSVFYTIVIPMLNPLIYSLRNKDVKSA
FKKVIGKCPVSHSIQI
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaataatgtcacaacagtaactgaattcatcctaatgggatttaatgaccac
cccaattgggagattcccctctttctggtgtttcttagcttatatcttgtcactatcctg
ggaaacttgggcatggtcattctcatccatatagatgttcaactccacatacctatgtac
ttcttcctgagccacctctctgtgttggatacttgttatacctcagtcatcactcctcag
attcttgccacactggctacaggcaaaacagccatttcctatggtcactgtgctgcccag
ttcttcttcttcactgtttgcgctggtacagaatgcttcctactttctgtgatggcctat
gatcgctatgttgctattagcaaaccactgctctacactgtggccatgcaccctaggaaa
tgttggagtttggtagtaggagcatatctttgtggagtgtctggagccatcctgcgtacc
acatgtaccttctctctctccttctgtgaaaataaccagatcaatttctttttttgtgac
ctcccacccctgctgaagctggcctgtagtgacacagcaaatgttgaaattattattgtc
ttctttgggaattttgtgattttggcaaatgccttagtcatactcatttcctacctgctt
attatcaaagctgtcatgaaaatgaagtcttcaggtagaagagccaagactttctcaaca
tgtgtctcccacctcactgctgtggctcttttatttgggacccttatctttatgtacata
cgaagtggttcaaaaaaatccctggaagaagataaagttgtgtctgtcttctacactatt
gtcattcccatgctgaatccactaatctatagcctaagaaacaaggatgtgaaatctgcc
ttcaagaaggttattggtaaatgcccggtctcccacagtatacaaatctga

DBGET integrated database retrieval system