KEGG   Rattus norvegicus (rat): 293828Help
Entry
293828            CDS       T01003                                 

Gene name
Mphosph10
Definition
(RefSeq) M-phase phosphoprotein 10
  KO
K14559  U3 small nucleolar RNA-associated protein MPP10
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    293828 (Mphosph10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    293828 (Mphosph10)
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:rno03009]
    293828 (Mphosph10)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     293828 (Mphosph10)
Ribosome biogenesis [BR:rno03009]
 Eukaryotic type
  90S particles
   U3 small nucleolar RNA-associated proteins
    293828 (Mphosph10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mpp10
Motif
Other DBs
NCBI-GeneID: 293828
NCBI-ProteinID: NP_001099810
RGD: 1307633
Ensembl: ENSRNOG00000016266
UniProt: G3V968
Position
1q22
AA seq 676 aa AA seqDB search
MAPRVFRRQTLERCLREVRKATNRPECFLTIQNGLASNLTSLTKVLYDFNKILEHGRISG
SPLQKLEIKSFDDEQIWQQLELQNEPVLQYFQDAVSEAVEDEDLSLLPECEDEECEEDAS
EVEADNQENVETDLEDEPLSDEGGHVPKGGDRAKSSRKPDPRKSPAFSDEDSDLDFDISK
LEQQTKMQIKPPRKPREKSVVDDKFFKLSEMESFLEKVEKEEEKTPDGEEEEEEDIDLFE
DIDSDENEGGLFGKQKIKSNKSSRNLKYKDFFDPVESDEEMTGVEGELGSDEEEGLPEEA
ADSMSESDEDNDLEEDENSGQQKGLKRVTFALPDDEAEDTSSLAVKQESDEVKSSFEKRQ
EKMNEKIASLEKELLDKKPWQLQGEVTAQKRPENSLLEETLHFDHAVRMAPVITEETTLH
LEDIIKQRIRDRAWDDVERKEKPKEDAYEYKKRLTLDHEKSKLSLAEIYEQEYIKLNQQK
AEEEDNPEHVEIQKMMDSLFLKLDALSNFHFIPKPPVPEIKVVSNLPAITMEEVAPVSVS
DAALLAPEEIKEKNKAGDLKTAAEKTATDKKRERRKKKYQKRLKIKEKEKRRKLLEKSNP
DHSKSSRAAASEKLKQLTKTGKVSLLKDERKDKPLKSSQAFFSKLQDQVKMQINDAKQPG
KIKKKKQDISVHKLKL
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atggcgccccgcgtgtttcgtcgacagacccttgaacggtgtctgagggaagtcagaaaa
gccaccaaccgacccgagtgtttcctcacgattcaaaatggactagcatcaaacctcact
tcattaacaaaagttctgtatgattttaataaaatattagagcatggccggatctccgga
agtcctttgcagaaacttgagataaagagttttgatgatgagcagatttggcaacaacta
gaactgcagaatgaaccagtcttacagtacttccaggatgcggttagtgaggcggttgag
gatgaagatctcagccttctcccagagtgtgaggatgaggagtgtgaagaggatgcctca
gaggtggaggctgacaaccaggagaacgtggagacagacttggaggatgaaccactgtca
gacgagggcggccatgttcctaaagggggtgacagagccaaaagctcaaggaaacctgac
ccgaggaaaagtcctgctttcagcgatgaggactctgaccttgactttgatattagcaag
ttggagcagcagaccaagatgcagatcaaaccacctagaaaaccaagggaaaagtctgta
gtagatgataagttcttcaaactgtccgaaatggagagctttttagaaaaagtggaaaaa
gaagaggaaaaaacacctgatggtgaagaggaggaagaggaagacattgacctttttgaa
gacattgattcagatgaaaatgagggagggctatttgggaagcaaaagattaagtcaaat
aaaagtagcagaaatctgaaatacaaggacttctttgatccagttgaaagtgatgaagaa
atgactggtgtggaaggcgagctggggtcagacgaagaggaagggctccctgaggaagca
gcagacagcatgtctgaatcggatgaagataatgacttggaagaagatgagaatagtggt
caacagaaaggcttgaaaagagtgacatttgctttgcctgatgatgaggctgaagatacg
agttccttagctgtaaagcaagaatccgatgaagttaaatcctcttttgaaaaaagacag
gagaagatgaatgagaaaatcgcatctttggaaaaagagctgttggataaaaagccttgg
cagcttcaaggggaagtgacagcgcagaagcggccagagaacagcctgctggaagagact
ctccacttcgaccatgctgtcaggatggcccctgtaatcacagaagaaactaccctccat
ctagaagatatcattaaacagaggatacgagatcgggcttgggatgatgtagaacggaaa
gagaaacctaaggaggatgcatatgaatataagaagcgtttgacgttagaccatgagaag
agcaagctaagtcttgctgagatttatgagcaggaatatatcaaactcaaccagcaaaaa
gctgaagaagaagacaatccagagcatgtagaaattcagaagatgatggattctctcttc
ctaaaactggatgccctgtcaaacttccacttcatccccaaaccgcctgttcctgaaatt
aaagttgtgtcgaatctgccagccataaccatggaggaagtggccccagtgagtgtcagt
gatgcagccctcctggccccagaggaaatcaaggagaaaaataaagctggagatctaaaa
acagctgctgagaaaacagctacagacaagaaacgagaacggaggaaaaagaaatatcag
aagcgtttgaaaataaaggagaaggagaagcggagaaaattgcttgaaaagagcaaccca
gatcattctaagtccagcagggcagcagcttccgagaagctcaaacagttgaccaaaaca
ggcaaagtgtccttgttaaaggatgaacgaaaagataagcccttaaagtcatctcaggca
ttcttttctaaattgcaagatcaagtaaaaatgcagattaatgatgcaaagcaacctgga
aagataaagaagaaaaaacaggacatttctgttcataaattaaagctgtaa

DBGET integrated database retrieval system