KEGG   Rattus norvegicus (rat): 29385
Entry
29385             CDS       T01003                                 

Gene name
Cxcr2
Definition
(RefSeq) C-X-C chemokine receptor type 2
  KO
K05050  C-X-C chemokine receptor type 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04072  Phospholipase D signaling pathway
rno04144  Endocytosis
rno05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    29385 (Cxcr2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    29385 (Cxcr2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    29385 (Cxcr2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    29385 (Cxcr2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    29385 (Cxcr2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    29385 (Cxcr2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    29385 (Cxcr2)
   04050 Cytokine receptors [BR:rno04050]
    29385 (Cxcr2)
   04090 CD molecules [BR:rno04090]
    29385 (Cxcr2)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    29385 (Cxcr2)
Cytokine receptors [BR:rno04050]
 Chemokine receptors
  CXC Chemokine
   29385 (Cxcr2)
CD molecules [BR:rno04090]
 Proteins
  29385 (Cxcr2)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 29385
NCBI-ProteinID: NP_058879
RGD: 2906
Ensembl: ENSRNOG00000014269
Vega: OTTRNOG00000001499
UniProt: P35407
Position
9
AA seq 359 aa
MGEIRVDNFSLEDFFSGDIDSYNYSSDPPFTLSDAAPCPSANLDINRYAVVVIYVLVTLL
SLVGNSLVMLVILYNRSTCSVTDVYLLNLAIADLFFALTLPVWAASKVNGWIFGSFLCKV
FSFLQEITFYSSVLLLACISMDRYLAIVHATSTLIQKRHLVKFVCITMWFLSLVLSLPIF
ILRTTVKANPSTVVCYENIGNNTSKWRVVLRILPQTYGFLLPLLIMLFCYGFTLRTLFKA
HMGQKHRAMRVIFAVVLVFLLCWLPYNIVLFTDTLMRTKLIKETCERQNEINKALEATEI
LGFLHSCLNPIIYAFIGQKFRHGLLKIMANYGLVSKEFLAKEGRPSFVGSSSANTSTTL
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgggagaaatcagggtggataatttcagccttgaagacttcttcagtggagatattgac
agttacaattacagttctgacccgccctttactctgtcagatgctgccccatgcccctca
gcgaacctagatatcaacaggtatgctgtggttgtcatatacgttctggtgactttgctg
agtctcgtgggaaactccctggtgatgctggtcatcttgtacaatcgaagcacctgctct
gtcaccgacgtctacctgctgaacctggccattgctgatctgttctttgccctgaccttg
cctgtctgggctgcatctaaagtaaatggatggatttttggctcattcctgtgcaaggta
ttctcgttcctgcaggagattaccttctacagcagtgttctgttgctagcctgcatcagc
atggaccgctacctggccatcgtccacgccacaagtacactgatccagaagagacacttg
gtcaagtttgtgtgcatcaccatgtggtttctctcactagttctgtccctgcccatcttc
attcttcggactactgttaaggcaaacccttctaccgtagtctgctatgagaatataggt
aataatacatccaagtggagggtggtactgcgcatcctgcctcagacctatggcttcctc
ctgccgctgctcatcatgctgttctgctatgggttcacactgcgcacgctctttaaggcc
cacatggggcagaagcaccgggccatgcgggtcatctttgctgtggtcctcgtcttcctg
ctctgctggcttccctacaacattgtcctgttcacagacaccctcatgagaaccaagctg
atcaaggagacctgtgaacgccagaacgagattaacaaagctttggaagctactgagatt
cttggcttcctccacagctgtcttaaccccatcatctatgcctttattggccagaaattt
cgccatggacttctcaagatcatggctaattatggccttgtcagcaaggagttcttagcc
aaggagggcaggccttcttttgttggctcttcttcagcgaacacctccactaccctctaa

DBGET integrated database retrieval system