KEGG   Rattus norvegicus (rat): 293854
Entry
293854            CDS       T01003                                 

Gene name
Srpk3, Mssk1, Stk23
Definition
(RefSeq) SRSF protein kinase 3
  KO
K08832  serine/threonine-protein kinase SRPK3 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    293854 (Srpk3)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     293854 (Srpk3)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  SRPK family [OT]
   293854 (Srpk3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal
Other DBs
NCBI-GeneID: 293854
NCBI-ProteinID: NP_908934
RGD: 727856
Ensembl: ENSRNOG00000054548
UniProt: G3V8I2
Position
Xq37
AA seq 563 aa
MSASAGGSGGMDCGGSSSSSQTSCGPESSSSELAPATPAPRLLQGLLGSDDEEQEDPKDY
CKGGYYPVKIGDLFNGRYHVVRKLGWGHFSTVWLCWDIQRKRFVALKVVKSAGHYTETAV
DEIKLLKCVRDSDPSDPKRETIVQLIDDFRISGVNGVHVCMVLEVLGHQLLKWIIKSNYQ
GLPVPCVKSIVRQVLHGLDYLHTKCKIIHTDIKPENILLCVGDAYIRRLAAEATEWQQSG
AQPPSRSTVSTAPQEVLLSKNKRKKMRRKRKQQKRLLEERLRDLQRLEAMEAAVQTEDSS
SRLEQGSGSTSSSGCHPEGTRAGPSPASSSPVPTGGERSLSPSSQTSGFSGSLFSTASCS
VLSGSSNQRETGGLLSPSTPFGASNLLVNPLEPQNADKIKIKIADLGNACWVHKHFTEDI
QTRQYRAVEVLIGAEYGPPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIAHIVEL
LGDIPPAFALSGRYSREFFNRRGELRHIHNLKHWGLYEVLMEKYEWPLEQATQFSAFLLP
MMEYIPEKRASAADCLQHPWLNP
NT seq 1692 nt   +upstreamnt  +downstreamnt
atgagtgccagtgccggtggtagtggtggtatggactgtggtggcagcagcagcagctct
cagacttcctgtgggcctgagtcctcaagctctgaattagctccagccacaccagcacct
cgtttgctgcagggactcctgggctctgatgatgaggagcaggaagaccctaaggattat
tgcaagggtggttactacccagtgaagatcggtgatttgttcaatgggcggtaccatgtg
gtacgaaagctaggctggggccatttctctactgtctggctctgctgggatattcagcgc
aagcgctttgtggctctgaaagtagtgaagagcgcaggacattacacagagacagccgtg
gatgagatcaagctcctgaaatgtgttcgggacagtgaccctagtgaccccaaaagagag
accattgttcaacttatcgatgacttcaggatctcaggagttaatggagtccatgtatgc
atggtgctagaggtcctgggccaccagctcctgaagtggatcatcaagtccaattaccag
ggcctgcctgtgccctgtgttaagagcatcgttaggcaggtgctgcatggtctggattac
ctccatactaagtgcaagatcatccatacggacatcaagcctgagaacattctactgtgt
gttggagatgcctacatcaggcgcctggctgctgaagccacagagtggcagcagtcaggg
gcccagcccccatcccgctccacagtcagcactgccccccaggaggtcttgctgtccaaa
aacaagaggaagaagatgaggcgcaaaaggaagcaacagaaaaggctgctggaggagcgg
ctgagggacttgcagaggctggaggctatggaggctgcagtacaaactgaggactccagc
tcaagactagagcagggcagtggctccacctcttcttcaggctgccacccggaaggcacc
agggctggcccctctccagcctcttcttcccctgtgcccactgggggggaacgcagcctt
agtcccagctcgcagacctcaggcttctcagggtccctgttctccacggcttcctgctcc
gtcctctcaggctcatctaatcagcgtgagactgggggtctcctgtctcctagcacacca
tttggtgcttccaacctcctggtgaaccccctggaacctcaaaatgcagacaagatcaag
atcaagattgcagaccttggcaatgcctgctgggtgcacaagcacttcactgaggatatt
cagactcggcagtacagggccgtggaggtcctgattggtgctgagtatggccccccagct
gacatctggagcacagcatgcatggcttttgagctggccactggtgactacctatttgag
cctcactctggagaagactacagtcgtgatgaggaccacattgctcatatcgtggaactt
ctaggagacatccctccagcttttgccctctcaggcagatattcacgggagttcttcaac
cgtagaggagagctgcggcacatccacaacctcaagcactggggcctatatgaggtgctc
atggagaagtatgagtggcccctggagcaggccacacagttcagtgccttcctgttgccc
atgatggagtacatccctgagaagcgagccagtgctgccgactgcctccagcatccctgg
cttaatccctag

DBGET integrated database retrieval system