KEGG   Rattus norvegicus (rat): 293856Help
Entry
293856            CDS       T01003                                 

Gene name
Pdzd4, RGD1561214
Definition
(RefSeq) PDZ domain containing 4
  KO
K24056   
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: PDZ PDZ_6 PDZ_2 Tricorn_PDZ
Motif
Other DBs
NCBI-GeneID: 293856
NCBI-ProteinID: NP_001129308
RGD: 1561214
Ensembl: ENSRNOG00000056174
UniProt: D3ZLI9
Position
Xq37
AA seq 766 aa AA seqDB search
MGCNMCVVQKPEEQYKVMLQVNGKELSKLSQEQTLEALRASKEPLVIQVLRRSPRLRGDS
SCHDLQLVDSGTQTDITFEHIMALGKLRPPTPPMGILEPPPISHEYYDPAEFMEGGPQEA
ERMDELEYEEVELCKNSHQDKLGLMVCYRTDDEEDLGIYVGEVNPNSIAAKDGRIREGDR
IIQINGMDVQNREEAVAILSQEENTNISLLVARPESQLAKRWKDSDRDDFLDDFGSENEG
DLRTRKLKSPPVQQTGNDEKGAPDGGPGLSNSQDLDSGVGRTDESTRNEESSEHDLLGDE
PPSTTNTPGSLRKFGLQGDALQSRDFHFSMDSLLAEGAGLGGADLPGLTDEEYERYRELL
EIKCHLENGNQLGILFSRASSGNSALDVNRNESLGHEMAMLEEELRHLEFKCRNILRAQK
MQQLRERCMKAWLLEEESLYDLAASEPKKHELSDISELPEKSDKDSTSAYNTGESCRSTP
LLVEPLPESPLKRSAAGNSNLNRTPSGPPVTTHLKAAPSPGSPAKFRSLSRDPEVGRRQH
TEERVRRSTKTSVTLERVGPEGSPYLSRRHRGQEIEQYHSCVQLAPPRTLEDLSHGSLSL
ASGSRVGGVVAAAVEAPRMEWKVKVRSDGTRYVAKRPVRDRLLKARALKIREERSGMTTD
DDAVSEMKMGRYWSKEERKQHLIRAREQRKRREFMMQSRLECLREQQNGDSKPELNIIAL
SHRKTMKKRNKKILDNWITIQEMLAHGARSADGKRIYNPLLSVTTV
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atgggatgtaatatgtgcgtggtccagaaaccggaggagcaatacaaagtgatgcttcag
gtgaacgggaaggagctctccaagctgtctcaggagcaaaccctagaggccctgcgtgcc
tccaaggagcccctggtgatccaggtgctaagacgcagcccccgtctgcggggggacagc
tcctgccatgaccttcagctggtggacagtggcactcagaccgacatcaccttcgagcat
atcatggcgctgggcaagctgcgcccgcccaccccacccatgggcatcttggagcccccc
cccatcagccatgagtattatgacccagcggagttcatggagggcggcccgcaggaggca
gagcgaatggacgagctggagtacgaggaggtggagctgtgtaaaaacagccaccaagac
aagctgggcctgatggtatgctatcgcacagatgatgaggaggacctaggcatctacgtt
ggagaggtaaatcccaacagcattgcagccaaagatggccggatccgtgagggagacaga
atcatccagattaatggaatggatgtccaaaaccgagaagaggcagtagccatcctgagc
caggaggagaacaccaacatctccctgctggtggcccggcctgagagccagctagcaaag
cggtggaaagacagtgacagagatgacttcctagatgactttggatctgagaatgaaggg
gaccttcgtacccggaagctaaagtccccccctgtccagcagactggaaatgatgagaag
ggggctcctgatgggggccctggcttgagcaacagccaggacctggacagcggggtaggc
cggacagatgagagtacccgcaacgaagagagctctgaacatgacctgctcggggatgaa
cctcccagcaccaccaacacccctggaagcctgcgcaagttcggtctacaaggggatgcc
ctacagagcagggacttccacttcagcatggattctctgctagctgagggggcagggctg
ggaggggctgacctgcctgggctcactgatgaggagtatgaacgctaccgggagctgcta
gagatcaagtgccacctggaaaatggcaaccagctgggtatcctcttctcccgggcctcc
agtggcaacagtgccctagatgtcaaccgcaatgagagcctaggccatgagatggccatg
ctagaggaagagcttcggcacctagagttcaagtgtcgcaatatcttgcgggcacagaag
atgcagcagttgcgggagcgctgtatgaaggcctggctgctggaggaagagagtctctat
gacctggcagccagtgagccaaaaaagcatgagctgtctgatatctctgaactgccagag
aaatcagacaaggatagtaccagcgcctacaacactggggagagctgccgcagcactcca
ctgcttgtggagcctctgcctgagagccccctgaagcgatctgctgctggcaattccaac
ttgaaccggaccccttctggccctcctgtcaccacccacctcaaggctgctccttcacca
gggagcccagccaagttccgatcactttctcgggatcctgaagtgggtcgtagacaacac
acagaagagcgtgtccgccgcagcaccaagacaagtgttactctggagcgtgtgggccct
gaaggtagcccttacctctctaggcgccatcgtggccaggagatcgagcagtaccacagc
tgtgtgcagttggccccgccacgtaccctggaggatctgagccatggctccttgagcttg
gctagtggttctcgggtgggcggggtggtggctgcagctgttgaagcaccccgcatggag
tggaaagtgaaggtgcgaagtgatgggacccgctatgtggccaagcggcctgtacgagat
cggctgctgaaggccagagccctgaagatccgagaggagcgcagtggtatgaccactgat
gatgatgcagtaagtgagatgaagatgggccgctactggagcaaagaagagaggaagcaa
cacctgattcgagcacgggaacaaaggaagcgtcgtgaattcatgatgcaaagccgtctg
gagtgtctaagggagcagcagaacggtgacagcaaacctgagctcaacattattgcgctg
agccaccgtaagaccatgaagaagcgaaacaagaagattctggacaactggatcaccatc
caggagatgctggcccatggtgcccgctcagctgatgggaaaaggatctacaaccctctg
ctctctgtcaccactgtctga

DBGET integrated database retrieval system