KEGG   Rattus norvegicus (rat): 29386
Entry
29386             CDS       T01003                                 

Gene name
Mecp2
Definition
(RefSeq) methyl CpG binding protein 2
  KO
K11588  methyl CpG binding protein 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    29386 (Mecp2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Heterochromatin formation proteins
   MBPs (metylated DNA binding proteins)
    29386 (Mecp2)
SSDB
Motif
Pfam: MBD
Other DBs
NCBI-GeneID: 29386
NCBI-ProteinID: NP_073164
RGD: 3075
Ensembl: ENSRNOG00000056659
UniProt: Q00566 A0A0G2JWK2
Position
Xq37
AA seq 492 aa
MVAGMLGLREEKSEDQDLQGLKEKPLKFKKVKKDKKEDKEGKHEPLQPSAHHSAEPAEAG
KAETSESSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKY
DVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPK
APGTGRGRGRPKGSGTGRPKAAASEGVQVKRVLEKSPGKLLVKMPFQASPGGKGEGGGAT
TSAQVMVIKRPGRKRKAEADPQAIPKKRGRKPGSVVAAAAAEAKKKAVKESSIRSVQETV
LPIKKRKTRETVSIEVKEVVKPLLVSTLGEKSGKGLKTCKSPGRKSKESSPKGRSSSASS
PPKKEHHHHHHHAESPKAPMPLLPPPPPPEPQSSEDPISPPEPQDLSSSICKEEKMPRAG
SLESDGCPKEPAKTQPMVAAAATTTTTTTTTVAEKYKHRGEGERKDIVSSSMPRPNREEP
VDSRTPVTERVS
NT seq 1479 nt   +upstreamnt  +downstreamnt
atggtagctgggatgttagggctcagggaggaaaagtcagaagaccaggatctccagggc
ctcaaagagaaacccctgaagtttaagaaggtgaagaaagacaagaaggaagacaaagag
ggcaaacatgaaccactacagccttcagcccaccattctgcagagccagcagaggcaggc
aaagcagagacatcagaaagctcaggctctgccccagcagtaccagaagcctctgcttct
cccaaacagcgacgttccatcattcgtgaccggggacctatgtatgatgaccccaccttg
cctgaaggttggacgcgaaagcttaaacagaggaagtctggtcgctctgctggaaagtat
gatgtatatttgatcaatccccagggaaaagcctttcgctctaaagtagaattgattgca
tattttgaaaaggtgggagacacctccttggaccctaatgattttgacttcactgtaact
gggagagggagcccttccaggagagaacagaaaccacctaagaagcccaaatctcccaaa
gctccaggaactggcaggggtcggggacgcccgaaagggagcggcactgggagaccaaag
gcagcagcatcagaaggtgttcaagtgaaaagggtcctggagaagagccctgggaaactt
ctcgtcaagatgcctttccaagcatcacctgggggtaagggtgagggaggtggggctacc
acatctgcgcaggtcatggtgatcaaacgccctggcagaaagcgaaaagctgaagctgac
ccccaggccattcctaagaaacggggtagaaagcctgggagtgtggtggcagctgctgct
gcagaggccaaaaagaaagctgtgaaggaatcttctatacggtctgtgcaggagactgtg
ctccccatcaagaagcgcaagacccgggaaaccgtcagcattgaggtcaaggaggtggtg
aagcccctgctggtgtctacacttggtgagaagagtggaaagggactgaagacatgcaag
agccctgggcgtaaaagcaaggagagcagccccaaggggcgcagcagcagtgcctcctca
ccacctaagaaggagcaccatcatcaccaccatcacgcagagtccccaaaggcccccatg
ccattgcttccacctccacccccacctgagcctcagagctctgaggaccccatcagcccc
cctgagcctcaggacttgagcagcagcatctgcaaagaggagaagatgccccgagcaggc
tcactggaaagcgatggctgccccaaggagccagctaagactcagcccatggttgctgcc
gccgccaccaccaccaccaccaccaccaccacagttgcagaaaagtacaaacaccgaggg
gagggagagcgcaaagacattgtttcatcctccatgccgaggccaaacagagaggagcct
gtggacagccggacgcccgtgaccgagagagttagctga

DBGET integrated database retrieval system