KEGG   Rattus norvegicus (rat): 293860
Entry
293860            CDS       T01003                                 

Gene name
Flna
Definition
(RefSeq) filamin-A
  KO
K04437  filamin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04510  Focal adhesion
rno05132  Salmonella infection
rno05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    293860 (Flna)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    293860 (Flna)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    293860 (Flna)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    293860 (Flna)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    293860 (Flna)
   04147 Exosome [BR:rno04147]
    293860 (Flna)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     293860 (Flna)
  Intermediate filaments
   Intermediate filament-binding proteins
    293860 (Flna)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   293860 (Flna)
SSDB
Motif
Pfam: Filamin CH Y_Y_Y Big_3_5 CFSR YtkA
Other DBs
NCBI-GeneID: 293860
NCBI-ProteinID: NP_001128071
RGD: 1560614
Ensembl: ENSRNOG00000054890
UniProt: C0JPT7
Position
X
AA seq 2639 aa
MSSSHSRSGQSAAGASPAGGIDTRDAEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCV
SKRIANLQTDLSDGLRLIALLEVLSQKKMHRKHNQRPTFRQMQLENVSVALEFLDRESIK
LVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEDEEAKKQTPKQRLLGWIQNKL
PQLPITNFSRDWQSGRALGALVDSCAPGLCPDWDSWDASKPVNNAREAMQQADDWLGIPQ
VITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNMVKK
RAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLF
AGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGIGEVEVVI
QDPTGQKGTVEPQLEARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNP
TACRAVGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYGF
EYYPTIPGTYTVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGIVGKSADFVVE
AIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFM
ADIREAPQDFHPDRVKARGPGLEKTGVAINKPAEFTVDAKHAGKAPLRVQVQDNEGHSVE
TTVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVA
KTGLKAHEPTYFTVDCTEAGQGDVSIGIKCAPGVVGPTEADIDFDIIRNDNDTFTVKYTP
CGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLNRTGVELGKPTHFTVNAK
TAGKGKLDVQFSGLAKGDAVRDVDIIDHHDNTYTVKYTPVQQGPVGVSVTYGGDHIPKSP
FSVGVSPSLDLSKIKVSGLVDKVDVGKDQEFTVKSKGAGGQGKVASKIVSPSGAAVPCKV
EPGLGADNSVVRFVPREEGPYEVEVTYDGVPVPGSPFPVEAVAPTKPSKVKAFGPGLQGG
NAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILF
ADTHIPGSPFKAHVVPCFDASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSE
AGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQC
YGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTDTYVQDCGDGTYKVE
YTPYEEGVHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVET
RGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKV
PVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVV
DNADGTQTVNYVPSREGSYSISVLYGEEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGV
PASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILI
KYGGDEIPFSPYRVRAVPTGDASKCTVTGAGIGPTIQIGEETVITVDTKAAGKGKVTCTV
CTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPTV
QTPLRPQQLPSQYTYPQGSQQTWIPERPMVGVNGLDVTSLRPFDLVIPFTIKKGEITGEV
RMPSGKVAQPSITDNKDGTVTVRYSPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHI
TAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVL
PGDYSILVKYNDQHIPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDLSLLTATVV
PPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDAS
RVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCP
TEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANVGSHCDLSLKIPE
ISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGMHTVSVKYKGQHVPGSPFQF
TVGPLGEGGAHKVRAGGPGLERAEAGVPAEFGIWTREAGAGGLAIAVEGPSKAEISFEDR
KDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSLQESGLKVN
QPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVYLIDVKFNG
THIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGSPAEFIVNTSNAGAGALSVTIDG
PSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLH
ETSSVFVDSLTKVATVPQHATSGPGPADVSKVVAKGLGLSKAYVGQKSNFTVDCSKAGNN
MLLVGVHGPRTPCEEILVKHMGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRIMVP
NT seq 7920 nt   +upstreamnt  +downstreamnt
atgagtagctctcactcccgctccggccagagtgcggcaggcgcgtctccggcaggcggt
attgatacacgggacgctgagatgccggctaccgaaaaagacctagcagaagatgcacca
tggaagaagatccagcagaacacatttacccgctggtgcaatgagcaccttaagtgcgtg
agcaagcgcatcgccaatctgcagacggacctgagcgatggattgcggctcatcgcgctg
cttgaggtactcagccagaagaagatgcaccgcaagcacaaccaacgacccactttccgc
cagatgcagctggaaaatgtgtctgtggcgcttgaattcctggaccgtgagagcatcaag
ctcgtgtccatagacagcaaggccattgtggatgggaatctgaaactgatcttaggactc
atctggaccctgatcctgcactactccatctcgatgcccatgtgggatgaggaagaggat
gaggaggccaagaagcaaacacccaaacagaggcttctaggctggattcagaacaagctg
ccacagctgcccattaccaacttcagtcgagactggcagagtggccgggccctgggtgct
cttgttgatagctgtgccccaggcctatgtcctgactgggactcctgggatgctagtaag
cctgtgaacaatgcacgggaagccatgcagcaggctgacgactggctgggcattcctcag
gtgattaccccagaagaaattgtggaccccaacgtagatgagcattctgttatgacttac
ctgtctcagtttcccaaggccaaactgaagccaggggctcctcttcggcccaaactgaac
ccaaagaaagcccgagcctatgggccaggcatcgagcccacaggcaatatggtgaagaag
agagcagaattcactgtggagacccgaagtgcaggacagggagaggtgctggtatatgtg
gaggacccagctggacaccaggaagaggcaaaagtgactgccaataacgacaagaaccgt
actttctctgtctggtatgtccctgaagtaacaggaactcataaggtgactgtgctcttt
gctggccaacatattgccaagagcccctttgaggtgtatgtggacaagtcacagggtgat
gccagcaaagtgactgcccagggccctggtctggagcccagcggcaatatcgccaacaag
actacctactttgagatcttcactgcaggagctggcataggcgaggtggaagttgtcatc
caggaccctacaggacagaaaggcacagtggaacctcagctggaggccaggggtgacagc
acctatcgctgtagctatcagcctaccatggagggtgtccatacagtacatgtcaccttc
gctggtgttcccatccctcgcagcccctacactgtcactgttggtcaagcttgtaaccca
actgcctgccgggctgttggtagaggcctccagcctaagggtgtgcgagtgaaggaaaca
gctgacttcaaggtgtacacaaaaggcgctggcagtggggagctaaaggtcactgtaaag
ggtcccaagggtgaagagcgtgtaaagcagaaggacttaggggatggtgtgtatggcttt
gaatattaccccacaatccctggcacatacactgtcaccatcacatggggtggccagaac
attggccgcagtccgttcgaggtgaaggtaggcactgagtgtggcaatcagaaggttcgg
gcatggggtcctggtctggaaggtggcattgttggcaagtcagcagacttcgtagtagag
gccattggtgatgatgtgggcaccttgggtttctctgtggaaggtccatcacaggcaaag
attgaatgtgacgacaagggtgatggctcttgtgatgtgcgctattggccccaggaggct
ggcgagtatgctgttcatgtgctatgtaacagtgaggatatccggctcagtcccttcatg
gctgacatccgtgaggcacctcaggattttcacccagaccgggtgaaggcacgtgggcct
ggattggagaagactggtgtagctatcaacaagccagcagagttcacagttgatgccaag
catgctgggaaggcccctcttcgagttcaagttcaggacaatgaaggacactctgtggag
acaacagtcaaggacaatggcaatggtacttacagctgttcttatgtgcccagaaagcca
gtgaagcacacagccatggtttcttggggaggtgtcagcatccccaatagtcctttccgg
gtgaatgtgggagctggcagccacccaaacaaagtcaaggtgtatggtccaggagtggcc
aagactgggctcaaggcccatgaacctacctactttactgtggattgtactgaggcgggc
cagggagatgtcagcattggtatcaagtgtgcccctggagtagtgggccccactgaggct
gatattgactttgatatcatccgtaatgacaatgacaccttcactgtgaaatacacaccc
tgtggggctggcagctataccatcatggttctttttgctgaccaggccacacccaccagc
cccatcagagtcaaagtggagccttctcatgatgccagtaaagtgaaggctgagggtcct
ggcctaaatcgcactggtgttgagcttggcaaacccacccatttcacagtcaatgctaaa
actgctgggaaaggcaagctggatgttcagttctcaggactggctaagggagatgcagtg
cgagatgtggacatcattgaccaccatgataatacctacaccgtaaagtatactcctgtg
cagcagggcccagtaggtgtcagtgtcacttatggaggagatcacatacccaagagtcca
ttttcagtgggagtatctccaagcctggatctcagcaagattaaggtgtctggccttgtt
gacaaagtggatgttggcaaagatcaagagttcacagtaaagtcaaagggtgcaggtggt
caaggcaaagtagcatccaagattgtgagtccctcaggtgcagcagtgccctgcaaggta
gagccaggcctgggagctgacaacagtgtggtccgttttgtgccccgtgaagaggggcct
tatgaggtggaagtgacctatgatggtgtgcctgtacctggcagtccctttccagtagaa
gctgtggctcctaccaaacccagcaaggtgaaggcatttggaccagggctgcaggggggc
aatgcaggctcccctgcccgcttcaccattgatacaaagggagctggcactggtggcctg
ggcctgacagtggaaggcccctgtgaagcacagcttgagtgcctggacaatggggacggt
acatgctctgtgtcttatgtgcccactgagcctggggactacaacatcaacatccttttt
gctgacacccacattcctggatccccattcaaggcccatgtggttccttgttttgatgca
tccaaggtgaagtgctcaggccctgggctggagcgggctactgctggtgaggtagggcag
ttccaagtagactgctcaagtgctggcagtgccgagttgacgattgagatctgctctgag
gcaggactgccagctgaagtatacattcaggaccatggtgatggcacacacaccattacc
tatattcctctttgtcctggggcttacactgttaccatcaagtatggtggccagcctgtg
cccaacttccccagcaagctacaggtggagcctgctgtagatacctcaggcgtacagtgc
tatgggcctgggattgaaggtcaaggtgtcttccgagaggcaaccactgagttcagtgta
gatgcccgggctcttacacagactggagggccacatgtcaaggcccgtgtggccaacccc
tcaggcaatctgacagatacctatgtgcaagactgtggtgatggcacatacaaagtggaa
tatactccatatgaggaaggagtacactccgtggatgtgacttatgatggcagccctgta
cccagcagccccttccaggtgcctgtaacagagggctgtgacccctcccgggtgcgtgtc
catgggccaggcatccaaagtggtaccaccaacaaacccaacaagttcacagtagagact
aggggagctggcacaggtggcctgggcttggctgttgagggtccctcagaggccaagatg
tcttgtatggataataaagatggcagctgctcggtagaatacatcccctatgaagctgga
acctatagccttaacgtcacttatggtggtcaccaagtgccaggtagccccttcaaggtt
cctgtacatgatgtgacagatgcatctaaagtcaagtgttctggacctggcttaagccca
ggcatggtccgtgccaacctccctcagtcctttcaggtagacacaagcaaagccggagtt
gccccactgcaggtcaaagtacaggggcccaaaggcctggtggagccagtggatgtagtg
gacaatgctgatggtactcagactgtcaactatgtgcccagccgagaagggtcctatagc
atttctgtgctgtatggtgaagaagaagtgccacggagccccttcaaggtcaaggtgctg
cccacgcatgatgccagtaaggtgaaggccagtggacctggactcaacaccactggtgtg
cctgccagcctgcctgtggagttcaccattgatgccaaggatgctggggagggtctgttg
gctgtccagattacggaccctgaaggcaagcccaagaagacacacatccaagataatcat
gatggcacatacacagtggcctatgtgccagatgtgacaggccggtacacaatcctcatc
aagtatggtggtgatgagatccccttttccccataccgtgtccgggctgtgcccactggg
gatgccagcaagtgcacagtcacaggtgctggcattggccccaccatccagattggagag
gagacagtgattactgtggacacaaaagcagcaggcaaaggcaaagtgacttgcacagtg
tgcacacctgatggctcagaggtagatgtggacgtggtggagaatgaggatggcaccttt
gacatcttctacacagccccgcaaccgggcaaatatgtcatctgtgtgcgcttcggtggc
gagcatgtgcccaacagccccttccaagttacagctttagctggggaccaaccaacagtg
cagaccccattaaggcctcagcagctgccttcacagtatacctatcctcagggtagccag
caaacatggattccagagaggcccatggtgggcgttaatgggctggatgtgaccagcctg
aggccctttgatcttgtcatccccttcactatcaagaagggtgagatcactggggaagtt
cgaatgccctctggcaaggtggcccagccttccatcactgacaacaaagatggcactgtt
actgtgcgttactcacccagtgaagctggcctgcatgaaatggacattcgctatgacaat
atgcatatcccaggaagccctctgcagttctatgttgattatgtcaactgtggtcacatc
actgcctatggtcctggccttacccatggagtggtcaacaaacctgccaccttcactgtc
aacaccaaggatgcaggagaagggggcttgtctctggccattgagggtccatctaaagca
gaaatcagctgcactgacaaccaggatgggacatgcagtgtctcttacctgcctgtgctg
cctggtgactacagcatcctagtcaagtacaatgaccagcacatcccaggcagccccttc
actgccagagtaacaggtgatgattccatgcgtatgtcccacctaaaggtgggttctgct
gctgatatccccatcaacatctcagaaacagacctcagcctactcacagccactgtggtg
ccaccttcaggtcgagaggaaccctgtctgctgaaacggttgcgtaatggccacgtgggg
atttccttcgtgcccaaggagacaggggagcacctggtacacgtgaagaagaatggccag
catgtggcaagcagtcccatcccagtagtgatcagccagtcggagataggtgatgccagc
cgtgtaagggtctctggtcaaggcctccatgaaggccatacctttgagcctgcagagttt
attattgacaccagagatgcaggctatggtgggctcagtctgtccattgagggccctagc
aaagtagacatcaacacagaggacctggaggacggcacatgcagggtcacctactgtccc
acagagcctggaaactacattataaacatcaaatttgctgaccaacatgtgcctggcagt
cctttttctgtgaaggtgacaggtgagggccgggtaaaagagagtatcacacgcaggcga
cgtgccccttctgtggccaatgttggcagtcattgtgacctcagcttgaagattcctgaa
attagcatccaagatatgacagcccaggtgaccagcccatcaggcaagacccatgaggca
gagattgtagaaggagagaaccatacttactgtatccgatttgtgcctgctgagatgggg
atgcatacagtcagtgtcaagtacaagggccagcatgtacctgggagccccttccagttc
actgtgggacctctgggggaagggggtgctcacaaggtccgtgctggaggccctggccta
gagagggctgaagctggagtaccagcggagttcggcatttggactagggaagctggcgct
ggaggcctggccattgctgttgaaggccctagcaaggctgagatctcttttgaggaccga
aaggatggctcttgtggtgtggcctacgtagttcaggagccaggtgactatgaggtctca
gtcaagttcaacgaggaacacatacctgatagccccttcgtggtgcctgtggcttctccg
tctggtgacgcccgccgccttactgtttctagtcttcaggagtcagggttaaaggtcaac
cagccagcatcttttgcagtcagcctgaatggagccaaaggggcaattgatgccaaggtg
catagcccctcaggagctctggaggagtgctatgtcacagagattgaccaagataagtat
gctgtgcgtttcatcccacgagagaatggcgtctacttgatcgatgtcaagttcaatggt
actcacatccctggaagtcccttcaagattcgagttggggagcctggtcatggaggggac
ccaggcttagtatccgcctatggagcaggcctggaaggtggtgtcacagggagcccagct
gagtttattgtgaacacaagcaatgcaggagctggtgccctttcggttaccattgatggc
ccctccaaggtgaagatggattgccaggagtgccctgagggctaccgtgtcacctatacc
cccatggcacctggcagctacctcatctccatcaagtatggtggcccctatcacattggg
ggaagccccttcaaagccaaggtcacaggtccccgtcttgttagcaaccacagcctccat
gagacatcatctgtgtttgtggactctctgactaaagttgctactgttccccagcatgca
acctcaggcccaggtcctgctgatgtcagcaaggtagtagccaaaggcctggggctaagc
aaagcttatgtaggccagaagagcaacttcacagtagattgcagcaaagcaggtaacaac
atgttgctggtgggcgtgcatggcccaaggacaccctgtgaagagatcctggtgaaacac
atgggcagtcgcctctatagtgtctcctacctgctcaaagacaaaggggaatacacattg
gtggtcaagtggggtgatgagcatatcccaggcagcccataccgcattatggtgccctga

KEGG   Rattus norvegicus (rat): 306204
Entry
306204            CDS       T01003                                 

Gene name
Flnb
Definition
(RefSeq) filamin-B
  KO
K04437  filamin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04510  Focal adhesion
rno05132  Salmonella infection
rno05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    306204 (Flnb)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    306204 (Flnb)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    306204 (Flnb)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    306204 (Flnb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    306204 (Flnb)
   04147 Exosome [BR:rno04147]
    306204 (Flnb)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     306204 (Flnb)
  Intermediate filaments
   Intermediate filament-binding proteins
    306204 (Flnb)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   306204 (Flnb)
SSDB
Motif
Pfam: Filamin CH Y_Y_Y CFSR Big_3_5 PapC_N CH_2
Other DBs
NCBI-GeneID: 306204
NCBI-ProteinID: NP_001100758
RGD: 1311915
Ensembl: ENSRNOG00000009470
UniProt: D4A8D5
Position
15
AA seq 2578 aa
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQK
RMHHKYHQRPTFRQMKLENVSVALEFLDHESIKLVSIDSKAIVDGNLKLILGLVWTLILH
YSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAP
GLCPDWESWDPRKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKA
KLKPGAPLKPKLNPKKARAYGRGIESTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNK
EEARVTPDSDKNKTYSVEYLPKVTGLHKVIVLFAGQHISKSPFEVNVDKAQGDASKVTAK
GPGLETTGNIANKPTYFDIYTAGAGVGDIGVEVEDPQGKNSVELLVEDRGNQVYRCVYKP
LQPGPHVVKVSFAGDAIPKSPFGVQIGEACNPNACRASGRGLQPKGVRIRETADFKVDTK
AAGSGELAVTVKGPKGLEELVKQKGFLDGVYSFEYYPSTPGKYSIAVTWGGHHIPKSPFE
VQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGTLGFAIEGPSQAKIEYDDQN
DGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGDYNPDLVQAYGPGLEKTGC
TINNPAEFIVDPKDAGNAPLKILAQDGEGQPIDIQMKSRMDGTYVCSYTPVKAIKHTIAV
VWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVG
IKCDARVLSDDEEDVDFDIIHNANDTFTVKYVPPAPGRYTIKVLFASEEIPASPFRVKVD
PSHDASKVKAEGPGLSKAGVENGKPTHFTVHTKGAGKAPLNVQFSSPVPGEAVKDLDIID
NYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKINGLENRVEVGK
DQEFAIDTNGAGGQGKLDVTILSPSRKVVPCLVAPVAGRECSTAKFIPREEGLFAVDVTY
DGHPVPGSPYTVEASLPPDPTKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEGP
CEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASG
PGLEHGKVGEPGILCVDCSEAGPGTLGLEAVSDSGAKAEVSIQNNKDGSYAVTYVPLTAG
MYTLTMKYGGELVPQFPTWVKVEPTVDTSGIKAFGPGIEGKDVFREATTDFTVDARPLTQ
VGGDHIKAHIANPSGASTECFVKDNADGTYQVEYTPFEKGFHVVEVTYDDAPIPNSPFKV
AVNEGCQPSRVHAQGPGLKEAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKD
GSCSAEYIPFAPGDYDVNITYGGVHIPGSPFRVPSKDVVDPSKVKIAGPGLSSCVRACIP
QSFTVDTSKAGLAPLEVRVMGPRGLVEPVDVVDNGDGTHTVTYTPSQEGPYIVSVKYADE
EIPRSPFKVKVLPTYDASKVTASGPGLSAYGVPASLPVEFAIDARDAGEGLLAVQITDQE
GKPQRATVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDNIPLSPYRIRATQTGDASKCLAT
GPGIAPTVKTGEEVGFVVDAKTAGKGKVTCVILTPDGTEAEADVIENEDGTYDIFYTAAK
PGTYVIYVRFGGVDIPNSPFTVMVTEEAYVPVSDMNGLGFKPFDLVIPFAVRKGEITGQV
HMPSGKKATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYVNYPNSGSV
SAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTL
PGDYSILVKYNDKHIPGSPFTAKITDDSRRCSQVKLGSAADFLLDISETDLSTLTASIKA
PSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARR
AKVYGRGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSKVDIQTEDLEDGTCKVSYFPT
VPGVYIVSTKFADEHVPGSPFTVKISGEGRVKESITRTSRAPSVATVGSICDLNLKIPEI
NSSDMSAHVTSPSGHVTEAEIVPVGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFT
VGPLGEGGAHKVRAGGPGLERGEAGIPAEFSIWTREAGAGGLSIAVEGPSKAEITFDDHK
NGSCGVSYIAQEPGNYEVSIKFNDEHIPDSPYLVPVIAPSDDARCLTVLSLQESGLKVNQ
PASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGIHTIDVKFNGS
HVVGSPFKVRVGEPGQAGNPALVSAYGAGLEAGTTGIQSEFFINTTQAGPGTLSVTIEGP
SKVKMDCQEIPEGYKVMYTPMAPGNYLISVKYGGPNHISRSPFKAKVTGQRLVTPGSANE
TSSILVESVTRSSTETCYSAIPKSSSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNM
LLIGVHGPTTPCEEVSMKHVGKQQYNVTYVVKEKGDYVLAVKWGEEHIPGSPFHVTVP
NT seq 7737 nt   +upstreamnt  +downstreamnt
atgccggtgaccgagaaagacctggcggaggacgcgccgtggaagaagattcagcagaac
acgttcacgcgctggtgcaacgagcacctcaagtgtgtgaacaaacgcatcgggaacctg
cagaccgacctgagcgacgggctgcggctcatcgcgttgcttgaggtgctcagccagaag
cgcatgcaccacaagtaccatcagcggcccaccttccgacagatgaagctggagaatgtg
tctgtggctctggagttcctagaccacgaaagcattaagctcgtgtccattgacagtaaa
gccatcgtggatgggaatctgaagctcatcttgggcctggtatggactttgatccttcac
tactccatctccatgcccgtgtgggaagacgagggggatgatgacgccaagaagcagacc
ccgaaacagaggctgctgggatggattcagaacaagatcccatacttgcccatcaccaac
ttcaaccagaactggcaagacggcaaagccttaggagccctggtagacagctgtgctccg
ggtctgtgcccggactgggaatcctgggacccacgaaagccggtggataatgctcgagaa
gccatgcagcaggccgacgactggctgggcgtcccacaggtcatcacgcccgaggagatt
attcacccggatgtggacgagcactctgtgatgacctacctgtctcagttccccaaagcc
aagctcaagccaggtgctcctcttaaacccaaactcaacccgaagaaagccagagcctat
ggcagaggaatcgagtccactggaaacatggtgaagcagccagccaaattcacggtagat
accatcagcgctggacaaggggatgtgatggtgtttgttgaggacccagaaggaaacaag
gaagaggctcgtgtgaccccagacagtgataagaacaagacatactctgtggagtatctg
cccaaagtcaccgggcttcacaaagtcatagtcctgtttgcaggacagcacatttccaag
agcccatttgaagtgaacgttgacaaagcccaaggagatgccagcaaagtcactgctaaa
ggcccagggttggaaactacagggaacattgccaataagcccacctactttgacatctac
acagctggtgctggtgtgggtgacattggcgttgaggtagaggatccccagggcaagaac
agtgtggagctcctggtagaagacagaggcaatcaggtgtatagatgtgtctacaagcca
ctgcagcctggcccccatgtggtcaaggtctcctttgctggggacgccattcccaagagc
ccctttggtgtacaaattggtgaagcctgtaacccaaatgcttgcagggccagtggccga
ggcctgcagcccaaaggcgtccggatccgggagactgcagactttaaggtggacaccaag
gcggctggaagcggagagcttgctgtaaccgtgaagggccctaagggcctggaggagctg
gtcaagcagaagggctttctggatggggtctactcgtttgagtactaccccagcacacca
gggaaatacagcattgcagttacttgggggggacaccacattccaaagagcccctttgaa
gttcaagttggccctgaggcaggcatgcagaaagtccgtgcatggggccctggactccac
ggtggcattgttggtcggtcagcagactttgtggtggaatccattggttctgaggtcggg
actctgggttttgccatcgaaggtccttcccaggcaaaaatcgagtatgacgatcagaac
gatggctcatgtgacgtcaaatactggcccaaggaacctggagaatatgccgttcacatc
atgtgcgacgacgaagacatcaaggacagcccatacatggctttcatccatcctgccaca
ggagactacaacccagatctagtccaagcatatgggccaggtctggagaaaactggttgt
actatcaacaacccagctgagttcatcgtagatcctaaggatgccgggaacgctccctta
aagatactggctcaggatggggaaggccagcccattgacatccagatgaaaagccggatg
gatggcacctatgtctgctcctataccccggtcaaagctatcaagcacaccatagctgtg
gtctggggaggggtgaacataccacacagcccctacagggtcaacattggacaaggtagc
catccccaaaaggtcaaagtgtttggaccgggcgtggagaggagtggtctgaaggcaaac
gagcctactcacttcacagtggattgcacggaggctggggaaggtgatgtcagtgttggt
atcaagtgtgatgcccgagtgttaagtgatgatgaggaagacgtcgatttcgacattatt
cacaatgccaacgacacgttcacagtcaaatacgtgcctcccgcccctgggcgatatact
atcaaggttctcttcgcatcggaggaaatccctgccagccctttcagagtcaaagttgac
ccttcccatgacgccagcaaggtgaaggcggaaggccctgggttgagtaaagcaggtgtg
gaaaatgggaagccgacccacttcactgttcacaccaagggagccggaaaagccccgctc
aatgtgcagttctccagcccggtccctggggaggcagtgaaggacttggatatcattgac
aactatgactactcccatactgttaaatacaccccaacccagcagggcaacatgcaggtc
ctggtgacttatggtggcgaccccattcccaaaagtcctttcactgtgggcgttgccgcg
ccgctggatctgagcaagataaaaatcaacggactagaaaacagagttgaggttgggaag
gaccaggaatttgccattgacaccaacggggcaggaggccaggggaagctggatgtgacg
atcctgagcccttctcggaaggtggtgccatgcttggtagcaccagtggctggcagagaa
tgcagcacagccaaattcatccctcgggaagaggggctgtttgctgtagacgtgacctat
gacggacacccagtgccggggagcccctacactgtggaggcctcactgccaccagatccc
accaaggtgaaggcccacggtcctggccttgaaggaggtcttgtaggcaagcccgcagag
ttcaccattgacactaaaggagctggaactggaggtttgggcctcactgtggaaggtccg
tgtgaggccaaaatcgaatgctctgataacggcgatgggacctgctccgtctcttacctt
cccacgaaacctggagaatactttgtcaacattcttttcgaagaagtccatattcccggg
tctcccttcaaagccgacattgagatgccatttgacccctctaaggttgtagcctcagga
ccaggactcgaacatggaaaagtgggtgaacctggaatcctttgcgttgattgttcagaa
gcagggcctgggactctgggccttgaagcggtctcagactcaggtgcgaaagccgaggtg
tccatccagaacaacaaagatggcagctacgctgtgacctatgtgcctctgacggccggc
atgtacaccctgaccatgaagtatggtggtgagcttgtaccacaattccccacctgggtc
aaggtggagcccaccgtcgacacgagtgggatcaaagcctttgggccaggaatcgaaggc
aaagatgtgttccgggaggccacaacagacttcacagttgatgctaggccccttacccag
gttggaggtgaccacatcaaagctcacattgccaacccgtcaggggcctcaaccgagtgc
ttcgtcaaggacaatgctgatgggacctatcaagtagaatacacaccatttgagaaaggt
ttccatgtagtagaggtgacatacgatgatgcgcccatcccaaacagcccattcaaagtg
gctgtcaatgaaggctgccagccatctcgggtccatgcccaaggccctgggctgaaagag
gctttcaccaacaagcctaatgtcttcacagtggtgaccaggggagcggggatcggtggg
cttggcatcactgtggaggggccgtcggagtcaaagataaactgcagagacaacaaagac
ggcagctgcagcgcggagtacatcccgtttgcgcctggggattacgacgttaatatcaca
tacggaggcgtccacatccctggcagccccttcagagtgccttcgaaagatgtcgtggat
cccagcaaggtcaaaattgctggccccggtctgagctcctgtgtccgagcatgcatccca
cagtccttcacggtggacaccagcaaggctggcctggctccactggaagtgagggtcatg
ggcccaagaggcctcgtggagccggtggatgtggtggataatggggatggcacccacaca
gtgacctacacgccatctcaggaggggccctacattgtttctgtcaaatacgctgatgaa
gagatcccccgaagtccctttaaggtcaaggtccttcccacatacgatgcgagcaaagtg
accgcctccgggcctggcctcagtgcctatggggtgcccgccagcttacctgtggagttt
gccattgatgccagagatgccggcgaaggcctacttgctgtccagatcacggaccaagaa
ggaaagcctcaaagagccaccgtccacgacaataaggatggcacctacgccgttacctat
atccctgataagaccggacgctatatgattggggtcacctatggtggagacaacatccca
ctttctccttatcgtatccgggccacgcagaccggcgatgccagcaagtgtttggccaca
ggtcctggcattgcccccactgtgaaaactggcgaggaagtgggcttcgtagtggatgct
aagactgcagggaaggggaaagtcacctgcgtgatcctcaccccagatggcacggaggct
gaagctgacgtcattgaaaatgaagatggcacctatgacattttctacactgccgccaag
ccaggcacctacgtgatctatgtgcgctttggtggcgttgatattcccaatagccccttc
acagtcatggttacggaagaggcctatgtcccagtgagtgacatgaacggactaggcttc
aagccctttgacttggtgattccgtttgccgtcaggaaaggagaaatcacaggccaggtg
catatgccgtctgggaagaaagctacccctgagattgtggacaacaaggacggcacggtc
actgtgagatatgcccccactgaagttggcctccacgagatgcacatcaagtacatgggc
agccacatccctgagagccccctccagttctacgtgaactaccccaacagtgggagtgtg
tctgcgtacggtccaggccttgtgtatggagtagccaacaaaaccgccaccttcaccatc
gtcacggaggatgctggagaaggtggtctggacttggctattgaagggccctcaaaagca
gagatcagctgcattgacaacaaagacgggacatgtacagtgacctacctgcccaccttg
ccaggggactatagcattctggtcaagtacaatgacaagcacatccctggcagccccttc
actgccaagatcacagatgatagcagacgctgctcccaagtgaagctgggctcggctgct
gacttccttctggacatcagtgagaccgacctcagcaccctgacagccagtatcaaggcc
ccatctggacgtgatgagccctgtctgctaaagagactacccaacaaccacattggcatt
tccttcatcccccgagaggtgggtgaacatctagtcagcatcaagaagaacggcaaccac
gtggccaatagccctgtatccatcatggtggtccagtctgagattggtgatgcacgccgt
gccaaagtctatggccgaggcctgtcagaaggccggactttcgagatgtctgacttcatc
gtggacacgagagatgcaggctatggtggcatatccttggcagtagaaggacccagcaag
gtggacatccagacagaggacctggaggacggtacctgcaaggtgtcctacttccccact
gtgcctggggtctatatcgtctccaccaaatttgctgacgagcatgtgcctggaagccca
ttcactgtgaagatcagcggtgagggaagagtcaaggagagcatcacccggacgagccgg
gctccatctgtggccacggttggcagtatctgtgacctgaacctgaagatcccagagatc
aacagcagtgacatgtctgcccatgtcaccagcccctctggtcatgtcaccgaggcagag
atcgtccctgtgggaaagaactctcactgtgtcagatttgtgccccaggagatgggcgtc
cacacagtcagcgtcaagtaccgtggacagcacgtaacaggaagccccttccagttcacc
gtggggccccttggagaagggggtgcccacaaggtccgagcaggaggccctggtctggag
aggggagaagcaggtatcccagccgagttcagcatctggacccgggaagcaggtgctggt
ggcctctccattgctgtcgagggccctagtaaggccgagatcacattcgatgaccataaa
aatgggtcatgcggtgtgtcttatattgcccaagagcctggtaactacgaggtgtctatc
aagttcaacgatgagcacatccctgacagcccttacctggtgcccgtcatcgcgccctca
gacgacgcccgctgcctcactgttctgagccttcaggagtcaggattaaaagttaaccag
ccagcatcctttgctataaggttgaatggcgccaaaggaaagattgacgcaaaggtgcac
agcccctcgggagccgtggaggaatgccacgtgtctgaactggagccagataagtacgct
gtgcgcttcatcccccatgagaatggcatccacacgatcgacgtcaaatttaatggcagc
cacgtggtcgggagccctttcaaagtgcgtgttggagagccaggccaagcagggaatcct
gctctggtgtcggcctacggggctgggcttgaggcaggtaccacaggtatccagtcagaa
ttcttcatcaacaccactcaggcaggcccggggacactgtctgtcaccattgaaggacca
tccaaggtcaaaatggattgccaggaaatcccagaagggtacaaagtcatgtatactccc
atggctcctggaaattacctgatcagtgtcaaatatggcgggcccaaccacatctcgagg
agtccattcaaggccaaggtgacaggccaacgtctggttaccccaggctcagccaacgag
acctcgtccatcttggtggaatcagtaaccagatcctcaacggaaacatgctatagcgcc
atccccaagtcgtcctcagatgccagcaaagtgacctccaagggggcggggctgtcaaag
gcctttgtgggccagaagagttccttcctggtggactgcagcaaagctgggtccaacatg
ctgttgattggggtccatgggcccaccaccccctgtgaagaggtctccatgaagcacgtg
ggcaagcaacagtacaatgtcacatacgttgtcaaggagaagggagattacgttctggct
gtgaagtggggggaagagcacatccccggtagcccctttcatgtcactgtgccttaa

KEGG   Rattus norvegicus (rat): 362332
Entry
362332            CDS       T01003                                 

Gene name
Flnc
Definition
(RefSeq) filamin-C
  KO
K04437  filamin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04510  Focal adhesion
rno05132  Salmonella infection
rno05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    362332 (Flnc)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    362332 (Flnc)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    362332 (Flnc)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    362332 (Flnc)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    362332 (Flnc)
   04147 Exosome [BR:rno04147]
    362332 (Flnc)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     362332 (Flnc)
  Intermediate filaments
   Intermediate filament-binding proteins
    362332 (Flnc)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   362332 (Flnc)
SSDB
Motif
Pfam: Filamin CH Big_3_5 YtkA CFSR Invasin_D3
Other DBs
NCBI-GeneID: 362332
NCBI-ProteinID: NP_001178791
RGD: 1308807
Ensembl: ENSRNOG00000007281
UniProt: D3ZHA0
Position
4
AA seq 2726 aa
MMNNSNYSDASGLGLLDEADEMPSTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVGKRLTD
LQRDLSDGLRLIALLEVLSQKRMYRKFHPRPNFRQMKLENVSVALEFLEREHIKLVSIDS
KAIVDGNLKLILGLIWTLILHYSISMPMWEDEDDEDARKQTPKQRLLGWIQNKVPQLPIT
NFNRDWQDGKALGALVDNCAPGLCPDWEAWDPNQPVQNAREAMQQADDWLGVPQVIAPEE
IVDPNVDEHSVMTYLSQFPKAKLKPGAPVRSKQLNPKKAIAYGPGIEPQGNTVLQPAHFT
VQTVDAGVGEVLVYIEDPEGHTEEAKVVPNNDKDRTYAVSYVPKVAGLHKVTVLFAGQNI
ERSPFEVNVGMALGDANKVSARGPGLEPVGNVANKPTYFDIYTAGAGTGDVAVVIVDPQG
RRDTVEVALEDKGDNTFRCTYRPVMEGPHTVHVAFAGAPITRSPFPVHVAEACNPNACRA
SGRGLQPKGVRVKEVADFKVFTKGAGSGELKVTVKGPKGTEEPVKVREAGDGVFECEYYP
VIPGKYVVTITWGGYAIPRSPFEVQVSPEAGAQKVRAWGPGLETGQVGKSADFVVEAIGT
EVGTLGFSIEGPSQAKIECDDRGDGSCDVRYWPTEPGEYAVHVICDDEDIRDSPFIAHIQ
PAPPDCFPDKVKAFGPGLEPTGCIVDRPAEFTIDARAAGKGDLKLYAQDADGCPIDIKVI
PNGDGTFRCSYVPTKPIKHTVIISWGGVNVPKSPFRVNVGEGSHPERVKVYGPGVEKTGL
KANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAG
HYTIMVLFANQEIPASPFHIKVDPSHDASKVKAEGPGLSRTGVEVGKPTHFTVLTKGAGK
AKLDVHFAGAAKGEAVRDFEIIDNHDYSYTVKYTAVQQGNMAVTVTYGGDPVPKSPFVVN
VAPPLDLSKVKVQGLNSKVAVGEEQAFLVNTRGAGGQGQLDVRMTSPSRRPIPCKLEPGS
GAEAQAVRYMPPEEGPYKVDITYDGHPVPGSPFAVEGVLPPDPSKVCAYGPGLKGGLVGT
PAPFSIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCAVSYLPTEPGEYTINILFAEAH
IPGSPFKATIQPVFDPSKVRASGPGLERGKAGEAATFTVDCSEAGEAELTIEILSDAGVK
AEVLIHNNADGTYHITYSPAFPGTYTITIKYGGHPIPKFPTRVHVQPAVDTSGIKVSGPG
VEPHGVLREVTTEFTVDARSLTATGGNHVTARVLNPSGAKTDTYVTDNGDGTYRVQYTAY
EEGVHLVEVLYDEVAVPKSPFRVGVTEGCDPTRVRAFGPGLEGGLVNKANRFTVETRGAG
TGGLGLAIEGPSEAKMSCKDNKDGSCTVEYVPFTPGDYDVNITFGGQPIPGSPFRVPVKD
VVDPGKVKCSGPGLGTGVRARVPQTFTVDCSQAGRAPLQVAVLGPTGVAEPVEVRDNGDG
THTVHYTPATDGPYTVAVKYADQEVPRSPFKIKVLPAHDASKVRASGPGLNASGIPASLP
VEFTIDARDAGEGLLTVQILDPEGKPKKANIRDNGDGTYTVSYLPDMSGRYTITIKYGGD
EIPYSPFRIHALPTGDASKCLVTVSIGGHGLGACLGPRIQIGEETVITVDAKAAGKGKVT
CTVSTPDGAELDVDVVENHDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVLACDPLP
HVEEPAEVLQLHQPYAPLRPGTCPTHWATEEPVVPVEPLESMLRPFNLVIPFTVQKGELT
GEVRMPSGKTARPNITDNKDGTITVRYAPTEKGLHQMGIKYDGNHIPGSPLQFYVDAINS
GHVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITCKDNKDGTCTVSYL
PTAPGDYSIIVRFDDKHIPGSPFTAKITGDDSMRTSQLNVGTSTDVSLKITEGDLSQLTA
SIRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVRKSGKHVTNSPFKILVGPSEIG
DASKVRVWGKGLSEGQTFQVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVT
YCPTEPGTYIINIKFADKHVPGSPFTVKVTGEGRMKESITRRRQAPSIATIGSTCDLNLK
IPGNWFQMVSAQERLTRTFTRSSHTYTRTERTEISKTRGGETKREVRVEESTQVGGDPFP
AVFGDFLGRERLGSFGSITRQQEGEASSQDMTAQVTSPSGKTEAAEIVEGEDSAYSVRFV
PQEMGPHTVAVKYRGQHVPGSPFQFTVGPLGEGGAHKVRAGGTGLERGVAGVPAEFSIWT
REAGAGGLSIAVEGPSKAEIAFEDRKDGSCGVSYVVQEPGDYEVSIKFNDEHIPDSPFVV
PVASLSDDARRLTVTSLQETGLKVNQPASFAVQLNGARGVIDARVHTPSGAVEECYVSEL
DSDKHTIRFIPHENGVHSIDVKFNGAHIPGSPFKIRVGEQSQAGDPGLVSAYGPGLEGGT
TGVSSEFIVNTQNAGSGALSVTIDGPSKVQLDCRECPEGHVVTYTPMAPGNYLIAIKYGG
PQHIVGSPFKAKVTGPRLSGGHSLHETSTVLVETVTKSSSSRGASYSSIPKFSSDASKVV
TRGPGLSQAFVGQKNSFTVDCSKAGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVTYTVK
EKGDYILIVKWGDESVPGSPFKVNVP
NT seq 8181 nt   +upstreamnt  +downstreamnt
atgatgaacaacagcaactactccgacgcctccggcctcggcctgcttgacgaggcggac
gagatgccgtccaccgagaaggacctagcggaggacgcgccgtggaagaagatccagcaa
aacacattcacgcggtggtgcaacgagcatctcaagtgtgtgggcaagcggctgaccgac
ctgcagcgagacctcagcgacgggctgcgcctcatcgcgctgctcgaagtgctcagccag
aagcgcatgtaccgcaagttccacccgcgccccaacttccgccagatgaagctggaaaat
gtgtctgtggccctggagttcctggagcgcgaacacatcaagctcgtgtccatcgacagc
aaggccatcgtggatgggaacctgaagctaatcctgggcctgatctggacactgatcctt
cactactccatctctatgcccatgtgggaggatgaagacgatgaggatgcccgcaaacag
acgcccaagcagcgactgctcggctggatccagaacaaagtgccccagctgcccattacc
aactttaacagggactggcaggacggcaaggctctgggtgccctggtggacaactgtgcc
cctggtctctgccctgactgggaagcctgggaccccaaccagcctgtgcagaatgccaga
gaagccatgcagcaagccgatgactggctcggggtgccccaggtgattgcccctgaagag
atcgtggatcccaacgtggatgagcactctgtcatgacctacctgtcccagttccccaag
gccaagctcaaacccggtgcccctgtccgctctaagcagctgaatcccaagaaagccatt
gcctacgggcccggcattgagccccagggcaacaccgtgctgcagcctgcccacttcact
gtgcagacagtagatgctggtgtgggtgaggtgctggtctacatcgaggaccccgagggt
cacactgaggaggccaaagtggttcccaacaacgacaaggaccgcacatacgcagtctcc
tatgtgcccaaggttgctgggttacacaaggtgacggtcctcttcgctggccagaacatc
gagcgtagtccctttgaggtgaatgtgggcatggctctcggggatgccaacaaggtatca
gcccgtggccctggtctggaacctgtgggtaatgtggccaacaaacccacctactttgac
atctatactgctggggctggcactggtgatgttgccgtggtgatcgtggacccacagggg
cggcgagatacagtagaggtggccctggaggacaaaggtgacaacacattccgatgcaca
tacaggcccgtgatggaagggccacacaccgtgcatgtggcctttgccggtgcacccatc
acccggagtcccttccccgtccatgtggcagaagcttgtaatcccaacgcctgcagagcc
tctgggcgaggcctgcagcccaaaggtgtgcgtgtgaaggaggtggctgacttcaaggtg
ttcaccaagggtgctggcagcggggaactcaaggtcacagtcaagggtccaaagggcaca
gaggagccagtgaaggttcgggaggctggagacggtgtgttcgagtgcgagtactaccca
gtgatacctgggaagtatgtggtgaccatcacttggggtggctatgccatcccccgcagt
ccttttgaggtccaggtgagcccagaggccggagcccagaaagtacgggcatggggtcct
ggtttggagactggccaggtgggcaagtcagctgacttcgtggtggaagccattggcaca
gaagtggggacgctgggcttctctattgaggggccctcgcaagccaagatcgagtgtgat
gacaggggtgatggctcctgtgacgtgcggtactggcccacggagcccggggagtatgct
gtgcacgtcatctgtgacgatgaagacatccgggactcacctttcatcgcccacattcag
ccagccccaccagactgcttcccagacaaggtgaaagccttcggacctggtctggagccc
actggctgcatcgtagacaggcctgcggagttcaccattgatgcccgtgctgctggcaag
ggagatttgaagctctatgcccaggatgcagatggctgccccatcgacatcaaggtgatc
cccaatggtgatggcaccttccgctgctcctacgtgcctaccaagcccattaagcatacc
gtcattatctcttggggaggtgtcaacgtgcccaagagccccttcagggtgaatgtagga
gaaggcagccatcctgagcgggtaaaagtatatggccctggagtggagaagacaggcctg
aaagccaacgaacccacctatttcacagtggactgcagtgaagctgggcaaggtgatgtg
agcattggcatcaaatgtgcccctggcgtggtggggcccgcggaagctgacatcgatttt
gacatcatcaagaatgacaatgacaccttcacagtcaagtacacacccccaggggccggc
cactacacgatcatggtgctgtttgccaaccaggaaatccctgccagtcccttccacatc
aaggtggacccgtcccacgatgctagcaaggtcaaggctgagggccctgggctgagccgc
acaggtgtggaagtcggaaagccaactcacttcactgtgctgaccaagggagctggcaag
gccaaactggacgtgcacttcgctggggcagccaagggcgaggctgtgcgagactttgaa
atcatcgacaaccatgactattcgtatactgtcaagtacactgctgtccagcagggcaac
atggcagtaacggtgacctacggtggagaccctgtccccaaaagtcccttcgtggtgaat
gtggcacccccactggacctcagcaaagtcaaagtccaaggcctgaacagcaaggtagct
gtgggagaggaacaagcgttcttggtgaacaccagaggggctggtggtcagggccaacta
gatgtgcggatgacctcaccctcccgacggcctatcccctgcaagctggaacctgggagt
ggagcagaagcccaggctgtccgctacatgccccctgaagaaggaccttacaaggtggac
atcacctatgatggtcacccagtgcctggcagcccctttgctgtggaaggcgtcctgccc
cctgacccctccaaggtctgcgcgtatggccctggtctcaagggtgggctagtaggcacc
ccggcaccattctccattgacaccaagggggccggcacaggaggcctggggctgactgtc
gagggcccctgcgaagccaagatcgagtgccaagacaatggtgatggatcttgtgcagtt
agctacctgcccacagagccaggcgagtacaccatcaatatcctgttcgctgaagcccac
atccctggctcacccttcaaggccaccatccagcctgtgttcgacccaagcaaggtgagg
gccagtgggccaggcctggagcgtggcaaggccggagaggcagccaccttcactgtggac
tgctcggaagcgggcgaggccgagctgaccatcgagatcctgtcagacgctggtgtcaaa
gcggaggtgctgatccacaacaacgcggatggcacctaccacatcacctacagtcctgcc
ttcccaggcacctacaccatcaccatcaagtatggcggccaccccatacccaagttcccc
acccgtgtccacgtgcagcctgcagttgataccagtggcatcaaggtctctgggcctggt
gtggaaccacatggtgtcctgcgggaggtgaccaccgaatttactgtggatgcaagatct
ctgacagctacaggtggcaaccacgtgacagctcgtgtgctcaacccctcgggtgctaag
acagatacctatgtgacagacaacggggatggcacctaccgggtgcagtacacggcctac
gaagagggtgtgcatttggtggaggtgctgtatgacgaagtagccgtgcccaagagcccc
ttccgagtgggtgtgacggagggctgtgaccccacccgagtccgggccttcggaccaggc
ctagagggtggcttggtcaacaaggccaaccgcttcactgtggaaactaggggtgctggc
acaggaggccttggcctagccatcgagggcccctcagaagctaagatgtcctgcaaggac
aacaaagatggcagttgcactgtggagtacgtccccttcactcctggggactatgatgtc
aacatcacctttgggggacaacccatcccaggaagcccattccgagttcctgtgaaggat
gttgtggaccctgggaaggtgaagtgttcagggccagggctagggactggcgtcagggct
cgggtacctcagaccttcacagtggactgcagtcaagctggccgggcccctctacaggtg
gcagtgctgggacccacaggtgtggctgagcctgtggaggtgcgtgacaatggcgacggt
acccacactgtccactacacgcctgccactgacggaccctatacagtagctgtcaagtat
gctgaccaggaggtgccacgcagccctttcaagatcaaagtgcttccggcccacgatgcc
agcaaagtgcgggccagtggccctggcctcaatgcctccggcatccccgccagcctgccc
gtggagttcaccattgatgctcgtgatgctggtgaggggcttctcacagtccagatcctg
gatcccgagggtaaacccaagaaggccaacatccgagacaatggggatggcacatacacc
gtgtcctacctgccagacatgagtggtcggtacaccatcaccatcaagtatggcggcgat
gagatcccttactcacccttccgtatccacgccctgcctacaggggatgccagcaagtgc
cttgttacagtatccattggaggccatggactgggtgcctgcctgggtcccagaatccag
attggagaggagactgtgattacagtggatgccaaggcagcaggcaaggggaaggtgacc
tgcacagtatccacacctgacggggcagagctcgatgtggatgtagttgagaaccacgat
ggtacctttgatatctactacacagcacctgagccgggcaaatatgtcatcaccatccgc
tttgggggtgaacacattcccaacagccccttccatgtgctggcatgtgacccgctgcct
catgtggaggagcctgcggaagtgctgcagctgcaccagccatatgccccacttcggcct
ggcacctgccccacacactgggccacagaggagcccgtggttcctgtggagcctttggag
tccatgctgaggcctttcaacttggtcatcccattcactgtgcagaaaggggagctgaca
ggggaggtccggatgccctctggtaaaacagcacgtcccaacatcactgacaacaaggac
ggtaccatcacagtgagatacgcacctacagagaaaggcctgcaccagatgggaatcaag
tacgatggcaaccatatccctgggagccctctgcagttctatgtggatgccatcaacagc
gggcatgtcagtgcctatgggccaggtctgagccatggcatggtcaacaagcctgccacc
ttcacaattgtcaccaaagacgctggggaaggggggctgtcactggctgtggagggccca
tccaaggcggagatcacctgcaaggacaacaaagatggcacctgtaccgtgtcctaccta
cccacagcacctggagactacagcatcattgtgcgctttgacgacaagcatatcccaggg
agccccttcacggccaagatcacaggtgacgactcaatgagaacgtcccagcttaatgtg
ggcacctccaccgatgtgtcactgaagatcacagagggtgacctcagccagctgacagcc
agtatccgtgctccttcaggcaatgaggagccttgcctgctgaagcgcttgcccaacagg
cacattgggatctcctttacccccaaggaggtcggtgagcatgtggtgagcgtacgcaag
agtggcaagcacgtcaccaacagcccctttaagattttggttgggccttcggagatcggc
gatgccagcaaagttcgagtctggggcaagggcctttccgagggacagaccttccaagtg
gcagagttcattgtggacactcgcaatgcaggctacggaggcctggggctgagcatcgaa
ggtcctagcaaggtggacattaactgtgaggatatggaagacggtacctgcaaagtcacc
tactgtccaactgaacctggcacctacatcatcaacattaagtttgctgacaaacacgtg
cctggaagtcccttcaccgtgaaggtgactggcgagggacgcatgaaggagagcatcacc
cggcgcagacaggcgccttccatcgccaccattggtagcacctgtgacctcaacctcaag
atcccaggaaactggtttcagatggtgtccgcccaggagcgcctgactcgcaccttcacg
cgtagcagtcacacgtacacccgcacggagcggacagagatcagcaagactcggggtggg
gagaccaagcgtgaagtccgggtggaggagtccacccaggtcggcggagaccctttccct
gctgttttcggcgattttctcggccgggaacgcctgggctcctttggaagcatcacccga
cagcaggaaggtgaggccagctctcaggacatgacagcccaggtgaccagtccatctggc
aagacagaagccgcagagatcgttgagggagaagacagcgcatacagtgtgcgctttgtg
ccccaggagatgggcccccacacagtcgctgtcaagtaccggggccaacatgtgcctgga
agcccttttcagttcaccgtgggtccgctaggtgaaggtggtgcccacaaggtgcgggct
ggaggcacagggctggagcgaggtgtagctggtgtgccagctgagtttagcatctggacc
cgagaagctggagctgggggcctgtccattgctgtggaaggtcccagcaaggcagagatc
gcattcgaagaccgcaaagatggttcttgtggtgtctcctatgttgtccaggagccaggt
gactatgaggtctccatcaagttcaatgatgagcacatcccagacagcccctttgtggtg
cctgtggcctccctctcagatgatgctcgccgcctcaccgtcaccagcctccaggagaca
gggcttaaggtgaaccagccagcatctttcgcggtgcagcttaatggggcacgtggcgtg
atcgatgcccgggtacacacaccctcaggagctgtggaggagtgctatgtctctgaactg
gacagtgataagcataccatccgcttcatcccccatgagaacggtgtccactcaattgat
gtcaagttcaacggtgcccacatccctggaagccccttcaagatccgcgttggggagcag
agccaagctggggacccaggcttggtgtcagcttatgggcctgggcttgaaggaggcact
acgggtgtatcgtcagagttcattgttaacacccagaatgcaggctcgggggccttgtct
gtcaccatcgatgggccttccaaggtgcagctggactgtcgggagtgtcctgagggccat
gtagtcacttacacgcccatggctcctggcaactacctcattgccatcaagtatggcggc
cctcagcacattgtgggcagtcccttcaaagcaaaggtcacaggtccccggttgtctgga
ggccacagccttcacgaaacatccacagttctggtggagactgtgacaaagtcctcctcg
agccgcggcgccagctacagttccatccccaagttctcctcagatgccagcaaggtggtg
acaaggggccccggcctgtcccaggcctttgtgggtcagaagaactccttcaccgtggac
tgcagcaaagcaggtaccaacatgatgatggtgggtgtgcacgggcccaagaccccctgc
gaagaggtatatgtgaagcacatggggaaccgggtctacaatgtcacctacactgtcaag
gagaaaggagactacatcctcattgtcaagtggggtgatgaaagtgtccctggaagcccc
ttcaaggtcaatgtgccctga

DBGET integrated database retrieval system