KEGG   Rattus norvegicus (rat): 293863Help
Entry
293863            CDS       T01003                                 

Gene name
Lage3, RGD1562476
Definition
(RefSeq) L antigen family, member 3
  KO
K15902  EKC/KEOPS complex subunit PCC1/LAGE3
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rno03016]
    293863 (Lage3)
Transfer RNA biogenesis [BR:rno03016]
 Eukaryotic type
  tRNA modification factors
   KEOPS/EKC complex
    293863 (Lage3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pcc1
Motif
Other DBs
NCBI-GeneID: 293863
NCBI-ProteinID: NP_001099815
RGD: 1562476
Ensembl: ENSRNOG00000053456
UniProt: D3ZPW6
Position
Xq37
AA seq 148 aa AA seqDB search
MQTAHAGLSHTAGGADSPTGRFCPGNAGTMAVLPSGAHPVARALEAPRNSSKSSVPLTQR
PGIRHHKFALFVPFPTSLEAEIACGSLAPDVEPHQGLVEKELKVSGSVLEVHWIAEDSRL
LRISIMNFLDQLSLVVNTIQLFGPPISC
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgcagacggcacacgcagggttaagccatactgcaggtggcgccgacagtccgactggc
cgcttctgtcctggtaatgcaggcacaatggcagttcttcctagtggagctcaccctgtt
gcaagagcactggaagccccccgaaattccagcaaaagctccgtgcctttaacccaaagg
cctggaatccgacatcataaattcgccctcttcgtgcctttccctacctctttggaggcg
gaaatcgcctgtgggtccctagctcctgatgtcgaaccacaccaaggactggtagagaag
gagcttaaagtgagcggcagcgtgctggaggtacactggatcgcagaagattctcgcctc
ctccgaatttccatcatgaactttcttgaccagctttctctagtggtgaacaccattcag
ctctttgggcccccgatttcctgttaa

DBGET integrated database retrieval system