KEGG   Rattus norvegicus (rat): 29387Help
Entry
29387             CDS       T01003                                 

Gene name
Pla2g2c
Definition
(RefSeq) phospholipase A2, group IIC
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00564  Glycerophospholipid metabolism
rno00565  Ether lipid metabolism
rno00590  Arachidonic acid metabolism
rno00591  Linoleic acid metabolism
rno00592  alpha-Linolenic acid metabolism
rno01100  Metabolic pathways
rno04014  Ras signaling pathway
rno04270  Vascular smooth muscle contraction
rno04972  Pancreatic secretion
rno04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    29387 (Pla2g2c)
   00565 Ether lipid metabolism
    29387 (Pla2g2c)
   00590 Arachidonic acid metabolism
    29387 (Pla2g2c)
   00591 Linoleic acid metabolism
    29387 (Pla2g2c)
   00592 alpha-Linolenic acid metabolism
    29387 (Pla2g2c)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    29387 (Pla2g2c)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    29387 (Pla2g2c)
  09154 Digestive system
   04972 Pancreatic secretion
    29387 (Pla2g2c)
   04975 Fat digestion and absorption
    29387 (Pla2g2c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    29387 (Pla2g2c)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     29387 (Pla2g2c)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    29387 (Pla2g2c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phospholip_A2_1
Motif
Other DBs
NCBI-GeneID: 29387
NCBI-ProteinID: NP_062075
RGD: 3340
Ensembl: ENSRNOG00000016647
UniProt: P39878 Q4V8L7
Position
5q36
AA seq 158 aa AA seqDB search
MDLLVSSGMKGIAVFLVFIFCWTTSTLSSFWQFQRMVKHITGRSAFFSYYGYGCYCGLGG
RGIPVDATDRCCWAHDCCYHKLKEYGCQPILNAYQFAIVNGTVTCGCTMGGGCLCGQKAC
ECDKLSVYCFKENLATYEKTFKQLFPTRPQCGRDKLHC
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggacctcctggtctcctcaggaatgaagggcatcgctgtcttccttgtctttatcttc
tgctggacaacctccaccctcagcagcttctggcagttccagaggatggtcaaacacatc
acggggcgcagcgccttcttctcctattacggatatggctgctactgtgggcttgggggc
cgagggatccctgtggacgccacagacaggtgctgctgggctcatgactgttgctaccac
aagcttaaggaatatggctgccagcccatcttgaatgcctatcagtttgccattgtcaac
gggaccgtgacctgtggatgcaccatgggtggcggctgcttgtgcgggcagaaagcctgt
gagtgtgacaaactgtctgtgtactgcttcaaggagaacctggccacctacgagaaaact
ttcaagcagctcttccccaccaggccccagtgtggcagggacaaactccattgctag

DBGET integrated database retrieval system