KEGG   Rattus norvegicus (rat): 29388Help
Entry
29388             CDS       T01003                                 

Gene name
Tnni1
Definition
(RefSeq) troponin I1, slow skeletal type
  KO
K10371  troponin I, slow skeletal muscle
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    29388 (Tnni1)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Troponins
     29388 (Tnni1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Troponin XkdW
Motif
Other DBs
NCBI-GeneID: 29388
NCBI-ProteinID: NP_058880
RGD: 621765
Ensembl: ENSRNOG00000009073
Vega: OTTRNOG00000000589
UniProt: P13413
Position
13q13
AA seq 187 aa AA seqDB search
MPEVERKSKITASRKLMLKSLMLAKAKECWEQEHEEREAEKVRYLSERIPTLQTRGLSLS
ALQDLCRELHAKVEVVDEERYDIEAKCLHNTREIKDLKLKVLDLRGKFKRPPLRRVRVSA
DAMLRALLGSKHKVSMDLRANLKSVKKEDTEKERPVEVGDWRKNVEAMSGMEGRKKMFDA
AKSPTLQ
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgccggaagttgagaggaaatctaagatcactgcctcccgtaaactcatgctgaagagc
ctgatgctagccaaggccaaggagtgctgggagcaggagcacgaggagcgagaggctgag
aaggtgcgttacctctcggagcgcatccctacgctgcagacccgcggtctttccctcagc
gcccttcaggacttatgccgagagctccatgccaaggtggaggtggtggatgaggagcgc
tatgatatcgaagccaaatgcctccacaacacgagagagatcaaggacctgaagctgaag
gtgctggacctccgtgggaagttcaagcgtccacccctgcgccgggtccgtgtctcagcc
gacgccatgctccgagccctactgggttccaaacacaaggtgtccatggatctgcgggcc
aacctcaagtctgtgaagaaagaagacacagaaaaggagcggccagtggaggtgggagac
tggaggaagaacgtggaggccatgtctggcatggaaggtcgcaagaagatgttcgatgct
gccaagtccccaaccttgcagtag

DBGET integrated database retrieval system