KEGG   Rattus norvegicus (rat): 29389Help
Entry
29389             CDS       T01003                                 

Gene name
Tnni2
Definition
(RefSeq) troponin I2, fast skeletal type
  KO
K12043  troponin I, fast skeletal muscle
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    29389 (Tnni2)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Troponins
     29389 (Tnni2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Troponin Tup_N DUF2408 DUF919 SKA2 Cluap1
Motif
Other DBs
NCBI-GeneID: 29389
NCBI-ProteinID: NP_058881
RGD: 62050
Ensembl: ENSRNOG00000020276
Vega: OTTRNOG00000000131
UniProt: P27768
Position
1q41
AA seq 182 aa AA seqDB search
MGDEEKRNRAITARRQHLKSVMLQIAATELEKEESRRESEKQNYLSEHCPPLHIPGSMSE
VQELCKQLHAKIDAAEEEKYDMEVKVQKSSKELEDMNQKLFDLRGKFKRPPLRRVRMSAD
AMLKALLGSKHKVCMDLRANLKQVKKEDTEKERDLRDVGDWRKNIEEKSGMEGRKKMFES
ES
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgggagatgaggagaagcgcaacagggccatcacggcccggagacagcacctgaagagt
gtgatgctccagatcgcggccacagagctggagaaagaggaaagccgccgcgaatccgag
aagcagaactacctgtcagaacactgcccgcctctgcacatcccaggctccatgtctgaa
gtgcaggaactctgcaaacaactgcatgcgaagatcgatgcggctgaagaggagaaatat
gacatggaggtgaaggtgcagaagagcagcaaggagctggaagacatgaaccagaagcta
tttgacctgaggggcaagttcaagaggcccccactccggagggtgcgtatgtcagctgac
gccatgctgaaggcgctgctgggctctaagcacaaggtgtgcatggacctgagagccaac
ctgaagcaggtcaagaaggaagacactgagaaggagcgggacctgcgtgacgtgggtgac
tggaggaagaatattgaggagaagtctggcatggagggtcggaagaagatgtttgagtct
gagtcctaa

DBGET integrated database retrieval system