KEGG   Rattus norvegicus (rat): 293890Help
Entry
293890            CDS       T01003                                 

Gene name
Mlana
Definition
(RefSeq) melan-A
  KO
K17303  melanoma antigen recognized by T-cells 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    293890 (Mlana)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of melanoma cells
   293890 (Mlana)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MLANA SKG6 DUF2371
Motif
Other DBs
NCBI-GeneID: 293890
NCBI-ProteinID: NP_001099818
RGD: 1306525
Ensembl: ENSRNOG00000036608
UniProt: D3ZWI9
Position
1q52
AA seq 116 aa AA seqDB search
MPREEVHFGYPRKGHSHSYITAEEAAGIGILVVALGIALLIGCWYCRRRSGYRALTDKRR
HAGTQNTSRERCLCESLDHQDSRLSSQEKNHQPVVPNAPPAYEKLSSDHSPPPYSP
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgccccgagaagaagttcacttcggttatcccaggaaggggcacagccactcttatatc
actgctgaagaggccgcagggattggcatcctggttgtagccctggggattgctctgcta
atcggctgctggtattgcagaagacgaagtggatacagagccttgacggacaaaaggcgt
catgctggtactcaaaatacctccagggaaagatgcttatgtgagagtcttgatcaccaa
gacagccgactgtcttctcaagaaaaaaaccaccaacctgtggttcccaacgctccacct
gcctatgagaagctctcttcagaccactcgccaccaccatattcaccctga

DBGET integrated database retrieval system