KEGG   Rattus norvegicus (rat): 29390Help
Entry
29390             CDS       T01003                                 

Gene name
Ptpmt1, Plip
Definition
(RefSeq) protein tyrosine phosphatase, mitochondrial 1
  KO
K14165  atypical dual specificity phosphatase [EC:3.1.3.16 3.1.3.48]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     29390 (Ptpmt1)
    3.1.3.48  protein-tyrosine-phosphatase
     29390 (Ptpmt1)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Atypical DSPs
    29390 (Ptpmt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc DSPn Y_phosphatase Y_phosphatase2 PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 29390
NCBI-ProteinID: NP_001099196
RGD: 1589783
Ensembl: ENSRNOG00000009723
UniProt: G3V7B6
Position
3q24
AA seq 251 aa AA seqDB search
MVPVPGSPGPASDGGDSASESREASGGPQLSSSASFSRWLTASSEAGGWPLRLAGWGGMA
ASAWLEAGLARVLFYPTLLYTVFRGRVGGPAHRDWYHRIDHTVLLGALPLRSMTRRLVLD
ENVRGVITMNEEYETRFLCNTSKEWKNVGVEQLRLSTVDMTGVPTLANLHRGVQFALKYQ
SLGQCVYVHCKAGRSRSATMVAAYLIQVHNWSPEEAIEAIAKIRSHISIRPSQLEILKEF
HKEIAARAAKN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggttcctgtcccgggatcccccgggcctgcctctgacggcggggactcagcttcggag
agtcgggaggcatcaggtggcccgcagctctcgtcctctgcgtccttctcgcggtggctg
accgcgagctccgaagcgggtggctggccgctgcgcttggcggggtggggcgggatggcg
gcgtccgcgtggctggaggccggcctggcccgggtgctcttctacccgacgctgctctac
acagtgttccgggggagggtgggcggcccggcgcaccgcgattggtaccaccgcatcgac
cacacagtgctgctgggcgcgctgccgctgaggagcatgacgcgccggctggtactggac
gagaacgtgcgcggagtgatcactatgaacgaggagtacgagaccagattcctgtgcaac
acctcgaaggaatggaagaatgtgggagttgagcagctacggctcagcacagtcgacatg
actggagtccccaccttggccaacctccacagaggagtccagtttgctctcaagtaccag
tccctgggccagtgtgtctacgtgcattgtaaggctggtcgatccagaagtgccacaatg
gtggcagcctatctgattcaggtacacaactggagcccagaggaggctatagaagctatc
gccaaaatccggtcacacatctccatcaggcccagccagttggaaattctcaaagagttc
cacaaggagattgctgcaagggcagcaaagaactaa

DBGET integrated database retrieval system