KEGG   Rattus norvegicus (rat): 293939Help
Entry
293939            CDS       T01003                                 

Gene name
Erlin1, RGD1307058, Spfh1
Definition
(RefSeq) ER lipid raft associated 1
  KO
K23341  erlin
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    293939 (Erlin1)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ERAD complex
    293939 (Erlin1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7 Catalase-rel DUF4346 Ribosomal_L33
Motif
Other DBs
NCBI-GeneID: 293939
NCBI-ProteinID: NP_001099823
RGD: 1307058
Ensembl: ENSRNOG00000012911
UniProt: B1WBY7
Position
1q54
AA seq 348 aa AA seqDB search
MNMTQARLLVAAVVGLVAILLYASIHKIEEGHLAVYYRGGALLTSPSGPGYHIMLPFITT
FRSVQTTLQTDEVKNVPCGTSGGVMIYIDRIEVVNMLAPYAVFDIVRNYTADYDKTLIFN
KIHHELNQFCSAHTLQEVYIELFDQIDENLKQALQKDLNTMAPGLTIQAVRVTKPKIPEA
IRRNFELMEAEKTKLLIAAQKQKVVEKEAETERKRAVIEAEKIAQVAKIRFQQKVMEKET
EKRISEIEDAAFLAREKAKADAEYYAAHKYATSNKHKLTPEYLELKKYQAIASNSKIYFG
SNIPNMFVDSSCALKYSDVRTEREGSLSPEETHEPSGESPIQNKENAG
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgactcaagcccggcttctggtggctgcagtggtggggttggtggcgatcctc
ctttacgcctccatccacaagatcgaggaaggacacctggccgtgtactacaggggagga
gctttactaactagccccagtggaccaggctatcatatcatgttacctttcattacaaca
ttcagatctgtgcagacaacactgcaaacggatgaagttaaaaatgtgccttgtggaaca
agtggtggagtcatgatctatattgaccgaatagaagtggttaatatgttggctccttat
gcagtatttgacattgtgaggaactatactgcagactatgacaagactttaatcttcaat
aaaatccaccatgagctgaaccagttttgcagcgcccacacacttcaagaagtttatata
gaattgtttgatcaaatagatgaaaacctgaagcaggccctgcaaaaagacttaaacacc
atggccccaggtctcactatccaggctgtgcgtgttacaaaacccaaaatcccagaagcc
ataagaagaaattttgagttaatggaggcagagaagacaaaacttcttatagctgcacag
aaacaaaaggttgtggagaaagaagctgagacagagaggaagagagctgttatagaagca
gagaagattgcacaagtggcaaaaattcgatttcaacagaaagtgatggagaaagaaact
gaaaaacgcatttctgagattgaagatgctgcgttcctggcccgagagaaggcgaaggca
gatgccgagtattatgctgcgcacaaatatgccacctcaaacaagcacaaattgacccca
gaatatctggaactcaagaagtaccaggccattgcttctaacagtaagatctactttggc
agcaacatccctaacatgttcgtggactcctcttgtgctttgaagtactctgatgttagg
actgaaagagaaggctccctttcccctgaggagactcatgaaccctctggagagagcccc
atccaaaacaaggagaacgcaggttga

DBGET integrated database retrieval system