KEGG   Rattus norvegicus (rat): 29397Help
Entry
29397             CDS       T01003                                 

Gene name
Ccl11, Scya11
Definition
(RefSeq) C-C motif chemokine ligand 11
  KO
K16597  C-C motif chemokine 11
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04657  IL-17 signaling pathway
rno05310  Asthma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    29397 (Ccl11)
   04061 Viral protein interaction with cytokine and cytokine receptor
    29397 (Ccl11)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    29397 (Ccl11)
   04062 Chemokine signaling pathway
    29397 (Ccl11)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    29397 (Ccl11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    29397 (Ccl11)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   29397 (Ccl11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 29397
NCBI-ProteinID: NP_062078
RGD: 3644
Ensembl: ENSRNOG00000007335
UniProt: P97545
Position
10q26
AA seq 97 aa AA seqDB search
MQLSTALLFLLLTATSFTSQVLAHPGSIPTSCCFTMTSKKIPNTLLKSYKRITNNRCTLK
AIVFKTKLGKEICADPKKKWVQDATKHLDQKLQTPKP
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atgcagctctccacagcacttctattcctgctgctcacggccacttccttcacctcccag
gtgctggctcacccaggttccatcccaacttcctgctgctttaccatgaccagtaagaag
atccccaacacactactgaagagctacaaaagaatcaccaacaacagatgcacgctgaaa
gccatagtcttcaagaccaagcttggcaaagagatctgtgctgaccccaagaaaaagtgg
gtccaggatgccacaaagcacctggaccaaaaactccaaactccaaaaccataa

DBGET integrated database retrieval system