KEGG   Rattus norvegicus (rat): 29398
Entry
29398             CDS       T01003                                 

Gene name
Stk10
Definition
(RefSeq) serine/threonine-protein kinase 10
  KO
K08837  serine/threonine kinase 10 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    29398 (Stk10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    29398 (Stk10)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     29398 (Stk10)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: STE group
  STE20 family
   29398 (Stk10)
SSDB
Motif
Pfam: PKK Pkinase PK_Tyr_Ser-Thr
Other DBs
NCBI-GeneID: 29398
NCBI-ProteinID: NP_062079
RGD: 3779
Ensembl: ENSRNOG00000004217
UniProt: H9KVF6
Position
10
AA seq 980 aa
MAFANFRRILRLSTFEKRKSREYEHVRRDLDPNDVWEILGELGDGAFGKVYKAKNKETGA
LAAAKVIETKSEEELEDYIVEIEILATCDHPYIVKLLGAYYYDGKLWIMIEFCPGGAVDA
IMLELDRGLTEPQIQVVCRQMLEALNFLHGKRIIHRDLKAGNVLMTLEGDIRLADFGVSA
KNLKTLQKRDSFIGTPYWMAPEVVLCETMKDAPYDYKADIWSLGITLIEMAQIEPPHHEL
NPMRVLLKIAKSDPPTLLTPSKWSTEFRDFLKIALDKNPETRPSAAQLLQHPFVSTVTSN
KALRELVAEAKAEVMEEIEDGKEDGREDGREDGEEEDGDEKDAVSAVPPPVNHTQDSSAN
GTQPSLNSDKLLQDSSTPLPPSQPQEPVNGPCNQPSGDGSPQNTSPADEVSKNDNGLKVP
VPLRKSRPLSVDARIQVTEEKQITDQAENPSSAASKPPKVNQSRPNSSALETLGVETLAN
GGLELPGSVTPNHSKRASDCSNLSTSESMDYGTSLSADLSLNKETGSLSLKGSKLHNKTL
KRTRRFVVDGVEVSITTSKIISEDEKKDEEMRFLRRQELRELRLLQKEEHRNQTQLSTKH
ELQLEQMHRRFEQEINAKKKFYDVELENLERQQKQQVEKMEQDHSVRRREEAKRIRLEQD
RDYARFQEQLKQMKKEVKLTVERLARNSRNSSSFQEQTEHPQAARRRDRDFVAKQKEDLE
LAMKKLTAENRREICDKERDCLNKKQELLRDREAALWEMEEHQLQERHQLVKQQLKDQYF
LQRHDLLRKHEKEREQMQRYNQRMMEQLKVRQQQEKARLPKIQRSDGKTRMAMYKKSLHI
NGAGSASEQREKVKQFSQQEEKRQKAERLQQQQKHENQMRDMVAQCESNMNELQQLQNEK
CHLLVEHETQKLKALDESHNQSLKEWRDKLRPRKKALEEDLNQKKREQEMFFRLSEEAET
RPTTPNRASKFFPYSSGDAS
NT seq 2943 nt   +upstreamnt  +downstreamnt
atggctttcgccaattttcgccgcatcttgcggttatccaccttcgagaagagaaagtcc
cgtgaatacgagcatgtccgcagggacctggaccccaacgacgtatgggagatcctgggc
gagctgggagacggcgccttcggcaaagtctacaaggccaaaaacaaggagacgggcgcc
ctggcagcagccaaagtcattgagactaagagcgaggaggagctggaggactacatcgtg
gagatcgagatcctcgccacctgcgaccacccatatatcgtgaagctcctgggggcctat
tactatgacgggaaactatggatcatgattgagttctgccctgggggagctgtggatgcc
atcatgctagagctggatcgaggcctcactgagccccagattcaggtcgtttgccgccag
atgttggaggctctcaacttcctgcacggcaagagaatcatccaccgcgacctgaaagct
ggcaacgtgcttatgaccctggagggggacatcaggctggctgattttggagtatctgcc
aagaatctgaaaactctgcaaaagcgagattccttcataggaacgccttactggatggcc
cctgaggtggtgctgtgtgaaaccatgaaggacgccccctatgactacaaggctgacatc
tggtccctgggcatcacgctgatcgagatggcgcagattgagcccccacaccatgagctc
aaccccatgcgggtcctgctcaagatcgccaagtcggaccctcccaccctgctcacaccc
tccaagtggtccacggagttccgagactttctgaagatagccttggataagaacccagaa
acccggcccagtgctgcgcagctgctgcagcatcccttcgtcagtacagtcaccagtaat
aaggcccttcgggagctggtggctgaggcgaaggctgaggtgatggaggagatcgaggac
ggcaaggaggacggcagggaggacggcagggaggatggagaagaggaggatggagacgag
aaggatgctgtgagtgctgttccgcccccagtcaaccacactcaggactcctctgccaat
ggaactcagccaagcctcaactctgacaagcttctccaggattcttctacccccctgcct
cccagccagcctcaggagcctgtgaacgggccctgtaaccaaccctcaggggatggatcc
ccccagaacaccagccctgcagatgaggtctccaagaatgacaatggcttaaaggtacct
gttcccctccggaagtcccggccattgtccgtggatgccagaattcaggtgaccgaagag
aaacaaatcactgaccaggctgagaaccccagttctgcagccagcaaacccccgaaggtc
aaccagagccgacctaacagcagcgccctggagactttgggtgtcgagactctggccaat
ggaggcctggagctccctggctctgtaactccaaaccattctaagagggcgtcggactgt
agcaacctgtctacctcagagagcatggactacggcacctccttgtctgctgacctgtca
ttgaacaaagagacgggctcattgtctctcaagggctcaaaactgcacaacaagaccctg
aagaggacccgccggtttgtggtggacggtgtggaggtgagcatcaccacctccaagatc
atcagcgaagacgagaagaaagacgaggagatgaggtttctcaggcgccaggaactccga
gagcttcggctcctgcagaaagaagagcatcggaaccagacgcagctgagcaccaagcac
gagctgcagctggagcagatgcacagacgatttgaacaagaaatcaacgccaagaagaaa
ttctatgacgtggagctagagaacctggagcggcagcagaagcagcaggtggagaagatg
gagcaggaccacagcgtgcgtcgcagagaggaggccaagcggatccgcctggagcaggat
cgagactacgccaggttccaagagcagctcaagcagatgaagaaggaggtgaagctgact
gtcgagaggttggctagaaatagtagaaatagttcttccttccaggaacagactgagcat
cctcaggcagctaggaggagggaccgagactttgtagccaagcagaaggaagacctggag
ctggccatgaagaagctcacggcagaaaacaggcgtgagatctgtgacaaggaacgtgat
tgccttaacaagaagcaggagctcctccgagaccgagaggcagccctgtgggagatggag
gagcaccagttacaggagagacatcagctggtgaagcagcagcttaaggaccagtacttc
ctgcagcggcatgacctgctgcgcaagcacgagaaggagcgggagcagatgcagcgctac
aaccagcgtatgatggagcagctgaaggtcagacagcagcaggagaaggcgcggctaccc
aagatccagaggagtgacggcaagacccgcatggccatgtacaagaagagcctgcacatc
aatggtgcgggcagtgcctccgagcagcgggagaaggtcaagcagttctcccagcaggaa
gagaagaggcagaaggcggagaggctgcagcagcagcagaaacacgagaaccagatgcga
gacatggtggcacagtgcgagagcaacatgaacgagctgcagcagctgcagaatgaaaag
tgtcatctgttagtggagcatgaaacccagaagctgaaggccctggacgagagccataac
cagagcctgaaggaatggcgagacaagcttcggccacgcaaaaaggccctggaagaggat
ttgaaccagaagaagcgggaacaggaaatgttcttcagactaagtgaggaggcagagacc
agacccaccacacccaacagagccagcaagttcttcccctacagctctggggatgcttcc
taa

DBGET integrated database retrieval system