KEGG   Rattus norvegicus (rat): 293991
Entry
293991            CDS       T01003                                 

Gene name
Ndufb8
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit B8
  KO
K03964  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
Module
rno_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    293991 (Ndufb8)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    293991 (Ndufb8)
  09159 Environmental adaptation
   04714 Thermogenesis
    293991 (Ndufb8)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    293991 (Ndufb8)
   05012 Parkinson disease
    293991 (Ndufb8)
   05014 Amyotrophic lateral sclerosis
    293991 (Ndufb8)
   05016 Huntington disease
    293991 (Ndufb8)
   05020 Prion disease
    293991 (Ndufb8)
   05022 Pathways of neurodegeneration - multiple diseases
    293991 (Ndufb8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    293991 (Ndufb8)
SSDB
Motif
Pfam: NDUF_B8
Other DBs
NCBI-GeneID: 293991
NCBI-ProteinID: NP_001099830
RGD: 1309129
Ensembl: ENSRNOG00000014078
UniProt: B2RYS8
Position
1q54
AA seq 186 aa
MAASRAAALGVRWLQRTSRCVVPLEARRAFHMTKDMMPGSYPRTPEERAAAAKKYNMRVE
DYEPYPDDGMGYGDYPMLPNRSQHERDPWYEWDHPDLRLNWGEPIHWDLDMYIRNRVDTS
PTPVSWDVMCRHLFGFVAFMVFMFWVGDMFPSYQPVGPKQYPYNNLYLERGGDPSKEPEP
VVHYEI
NT seq 561 nt   +upstreamnt  +downstreamnt
atggcggcgtcccgggctgcggccctgggagtccggtggctgcaaaggacatcccgctgc
gtggtgccacttgaggcacggagagccttccacatgaccaaggacatgatgccggggtca
tatcctaggaccccagaagaacgggccgcggccgccaagaagtataatatgcgtgtggaa
gactacgagccgtacccagatgatggcatggggtatggtgactacccgatgctccctaac
cgctcacagcatgagagggatccgtggtatgaatgggaccacccagacctcaggctgaac
tggggtgaaccgatacactgggacctagacatgtacatcaggaatcgtgtggacacatct
cctacaccggtttcctgggatgtcatgtgtagacatctcttcggctttgtggctttcatg
gttttcatgttctgggtaggggacatgttcccttcctaccagcctgtgggtccgaagcag
tacccgtacaataatctgtacctggagcgaggcggtgatccttccaaagaacctgagccc
gtggttcactatgagatctga

DBGET integrated database retrieval system