KEGG   Rattus norvegicus (rat): 294010
Entry
294010            CDS       T01003                                 

Gene name
Actr1a
Definition
(RefSeq) ARP1 actin-related protein 1 homolog A, centractin alpha
  KO
K16575  centractin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    294010 (Actr1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    294010 (Actr1a)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    294010 (Actr1a)
   04147 Exosome [BR:rno04147]
    294010 (Actr1a)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     294010 (Actr1a)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actin-related proteins
     294010 (Actr1a)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   294010 (Actr1a)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 294010
NCBI-ProteinID: NP_001099834
RGD: 1307025
Ensembl: ENSRNOG00000019725
UniProt: P85515
Position
1q54
AA seq 376 aa
MESYDVIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGP
KAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKN
RERAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSI
MRIDIAGRDVSRFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKDETLETEKAQ
YYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVL
SGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSK
KEYEEDGARSIHRKTF
NT seq 1131 nt   +upstreamnt  +downstreamnt
atggagtcctacgatgtgatcgccaaccagcctgttgtgatcgacaatggatccggtgtg
attaaagctggttttgctggtgatcagatccccaaatactgctttccaaactatgtgggc
agacccaaacatgttcgagtcatggcaggagccctcgaaggtgacatcttcattggcccc
aaagctgaggagcaccgggggctgctgtcaatccgctaccccatggaacatggcatcgtc
aaggactggaacgacatggagcgcatctggcaatatgtctattctaaggaccagctgcag
actttctcagaggagcatcctgtgctcctgactgaggcacctttaaaccctcggaaaaac
cgggagcgagcggcagaagttttcttcgagaccttcaatgtgccagctctcttcatctcc
atgcaagctgtgcttagcctttatgccacaggcagaaccacaggtgtggtgttggattct
ggggatggcgtcacccatgcagtcccgatttacgaaggcttcgccatgcctcactccatc
atgcgcattgacattgccggccgcgatgtctcacgcttcctccgcctctacctacgaaag
gagggctacgatttccactcctcctccgagtttgagattgtcaaggccataaaggaaaga
gcttgctacctgtccataaacccccagaaggatgagacactggagacggagaaggctcag
tactacctgcccgatggcagcaccattgagattggcccttccaggttccgggcccctgag
ctgctgttcaggcctgacttgattggcgaggagagtgagggtatccatgaggtgctggtg
ttcgctatccagaagtcagacatggatttacggcggacgctcttttccaacattgtcctc
tcaggaggttctaccctcttcaaaggttttggggacaggctactgagtgaagtgaagaaa
ctggctccaaaagatgtgaagatcaggatatctgcaccccaggagagactgtattccaca
tggattggaggctctatccttgcctccctggatacctttaagaagatgtgggtctccaag
aaggaatatgaagaagatggtgcccgatccatccacaggaaaaccttctaa

DBGET integrated database retrieval system