KEGG   Rattus norvegicus (rat): 294012
Entry
294012            CDS       T01003                                 

Gene name
Borcs7, RGD1311783
Definition
(RefSeq) BLOC-1 related complex subunit 7
  KO
K20821  BLOC-1 related complex subunit 7
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    294012 (Borcs7)
Membrane trafficking [BR:rno04131]
 Endosome - Lysosome transport
  Arf GTPases and associated proteins
   BLOC-one-related complex (BORC)
    294012 (Borcs7)
SSDB
Motif
Pfam: BORCS7
Other DBs
NCBI-GeneID: 294012
NCBI-ProteinID: NP_001127981
RGD: 1311783
Ensembl: ENSRNOG00000020076
UniProt: D3ZLX2
Position
1q54
AA seq 106 aa
MMASGTPDSQARFGQSVKGLLTEKVNTCGTDVIALTKQVLKGSRSSELLGQAARNMVLQE
DAILHSEDSLRKMAIITTHLQYQQEAIQKNVEQSPDLQDQLSHLLK
NT seq 321 nt   +upstreamnt  +downstreamnt
atgatggcgagtgggacgccggattcgcaagcccgatttggtcagtcggtgaaggggctt
ctcacggaaaaggtgaacacctgcggcaccgacgtaatcgcgctcaccaagcaggtgctg
aaaggctcgcgaagctctgagctgctggggcaggcagctcgaaacatggtgctacaggaa
gatgccatcttgcactcagaagatagtttaaggaagatggcgataataacaacacacctt
cagtaccagcaagaagctattcagaagaacgttgaacagtcgcctgacctgcaagaccag
ctgagtcatttactgaagtag

DBGET integrated database retrieval system