KEGG   Rattus norvegicus (rat): 294030Help
Entry
294030            CDS       T01003                                 

Gene name
Sfr1, LRRGT00030, Meir5, RGD1305481
Definition
(RefSeq) SWI5-dependent homologous recombination repair protein 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Mei5 Mei5_like RPN6_N
Motif
Other DBs
NCBI-GeneID: 294030
NCBI-ProteinID: NP_001041321
RGD: 1305481
Ensembl: ENSRNOG00000012641
UniProt: A0A0H2UHK0
Position
1q54
AA seq 256 aa AA seqDB search
MAEEEGNQEITSKMENPSDSASTSPDIPQTSENPPSPPTSPDKPQTSENPPSLHSNSSGK
QPMSGTLKERLKKARASSQPFCSVVKRIKVENEENDQTLSEPGESSKEENCSKAQESLEN
KDNEPEKESSEDKNTSESKSLDTGSSSVLQKDSTEKTIKQTLKEEKAKLTRQVQEKEDLL
RRLKLVKMYRIKNDVTELEDLIKKWRRCGQRLLCELQSIMSEDEDEKLTLTELIDYYGID
DKLLHYNRTEEEFTGV
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggaagaaggaaatcaggagatcacttccaagatggaaaacccctcagattca
gcatccacttcacctgacattcctcagaccagtgagaatccaccatcacccccaacctca
cctgacaagcctcagaccagtgaaaatccaccatcactccattcgaatagttcaggaaaa
caacctatgagtgggacacttaaagaaagattaaagaaagcaagagcttcatctcaacct
ttttgtagtgtggtgaagcgtattaaggtagagaatgaagaaaatgatcagaccctttca
gaaccaggagaatcttcaaaagaagaaaactgttcaaaagcccaagaaagcctggaaaac
aaagacaatgaacctgaaaaagagagctcagaggataaaaatacgagtgaatctaagtca
cttgatactgggtcatccagtgtcctccaaaaagattctactgagaagactataaagcaa
actttgaaggaagaaaaagcaaaactgactaggcaggttcaagagaaggaagaccttctt
cggaggttaaagttagtcaaaatgtacagaataaagaatgacgtgactgagttagaggat
ttaataaagaagtggaggaggtgtggccagcggctgctgtgcgagttgcagtcaatcatg
tccgaggatgaggacgagaagctgaccctcactgagttgatcgactactatgggatagac
gacaaattgctgcactataatagaactgaagaagagttcacaggggtttga

DBGET integrated database retrieval system