KEGG   Rattus norvegicus (rat): 294074Help
Entry
294074            CDS       T01003                                 

Gene name
Cep55, RGD1305340
Definition
(RefSeq) centrosomal protein 55
  KO
K16456  centrosomal protein CEP55
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    294074 (Cep55)
   03036 Chromosome and associated proteins [BR:rno03036]
    294074 (Cep55)
Membrane trafficking [BR:rno04131]
 Autophagy
  Other autophagy associated proteins
   Midbophagy associated proteins
    294074 (Cep55)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    294074 (Cep55)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EABR CC2-LZ zf-C2H2_3
Motif
Other DBs
NCBI-GeneID: 294074
NCBI-ProteinID: NP_001020817
RGD: 1305340
Ensembl: ENSRNOG00000016377
UniProt: Q4V7C8
Position
1q53
AA seq 462 aa AA seqDB search
MSSRSPKDLIKSKWGSRPSSSKSDTALEKFKGEIAAFKTSLDEITNGKGKVANKDRSKLL
EKIQVLEAEREKNVYYLMEKDKEIQRLKDHLRSRYSSSSLLEQLEEKTKECEKKQQLLES
LSRETDILKKQLSATTKRLSELESKASTLHLSQSVPANCFNSSMNSIHEKEMQLKDALEK
NQQWLVYDQQREAYVKGLLAKIFELEKRTETAAASLPQQMKKTESEGYLQEEKQKYDHLL
ENAKKDLEVERQTVTQLRLELDEFRRKYEETQKEVEDLNQLLSSQRKADIQHLEEDKHKT
EKIQKLREESSVFKGKLEEERKKSEELLSQVRILYDSLLKHQEEQSRVALLERQMQACTL
DFENEKLDRQNMQHQLYVILKELRKAKSQITQLESLKQLHGFTFTEQPFPLQGEPENRVK
ATSPKSPTAVLNESLVECPKCSVQYPATEHRDLLVHVEYCMK
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccagaagtcccaaagatttaattaaaagcaaatggggatcgaggcctagcagc
tccaagtcagacactgcgctagagaaatttaagggagaaattgcagccttcaaaacatcc
ctggatgaaatcaccaatgggaaaggaaaagtggccaataaagacagaagcaaacttctg
gagaaaattcaagttcttgaagccgagagagaaaagaatgtttattacctcatggagaag
gacaaagaaatacagagactcaaagaccacctaaggtcaagatatagctcttcgtcattg
ctcgagcagctggaggagaaaaccaaggagtgtgagaagaagcagcagttgctggagtcc
ttatccagagagacagatatcctgaaaaagcagttgtctgccacgacgaaaagactttcc
gaacttgaaagcaaagccagtacactccacctatcgcagagcgtgcctgcaaactgcttc
aactcatcaatgaatagtattcatgaaaaggaaatgcagctgaaagatgctctggagaaa
aatcagcagtggcttgtgtacgaccagcagcgagaagcctacgttaaagggcttttagca
aagatctttgagcttgaaaagagaacagagactgccgctgcttccctcccacagcagatg
aaaaagactgaatcagaaggttatcttcaagaggagaagcaaaaatatgatcatctcttg
gaaaatgccaaaaaagatcttgaagttgagcgacaaaccgtaactcagttgcgtttagaa
ctggatgaatttcgaaggaaatatgaagaaactcaaaaagaagttgaagatttaaaccag
ctgttgagttctcagcgcaaggcagacatacagcacctggaagaggacaagcataagacg
gagaaaatccagaagctcagggaagagagcagtgtcttcaaggggaaactggaagaggag
aggaagaagtctgaagagcttttatctcaggtccgaattctctacgattctctgttaaag
caccaagaggagcagagcagggtggctctgctggaacggcagatgcaggcatgtactcta
gactttgaaaatgaaaaactcgaccgccagaatatgcagcatcagctgtatgtgattctt
aaggagctccggaaagcaaaaagtcaaataacacagttggaatccttgaagcagctacat
ggatttaccttcacagagcagccgttcccactccagggagagcctgaaaacagagtgaaa
gctacctcacctaagagtcccactgctgttctcaacgaaagcctagtggaatgtcccaag
tgcagcgtacagtacccagccaccgaacatcgagacctgcttgtccatgtggaatactgc
atgaagtag

DBGET integrated database retrieval system