KEGG   Rattus norvegicus (rat): 294075Help
Entry
294075            CDS       T01003                                 

Gene name
Ffar4, Gpr120, O3far1
Definition
(RefSeq) free fatty acid receptor 4
  KO
K08425  free fatty acid receptor 4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    294075 (Ffar4)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Lipid
   Free fatty acid
    294075 (Ffar4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 294075
NCBI-ProteinID: NP_001040553
RGD: 1308252
Ensembl: ENSRNOG00000021763
UniProt: Q2AC31
Position
1q53
AA seq 361 aa AA seqDB search
MSPECAQTTGPGPSRTPDQVNRTHFPFFSDVKGDHRLVLSVLETTVLGLIFVVSLLGNVC
ALVLVVRRRRRGATVSLVLNLFCADLLFTSAIPLVLVVRWTEAWLLGPVVCHLLFYVMTM
SGSVTILTLAAVSLERMVCIVRLRRGLSGPGRRTQAALLAFIWGYSALAALPLCILFRVV
PQRLPGGDQEIPICTLDWPNRIGEISWDVFFVTLNFLVPGLVIVISYSKILQITKASRKR
LTLSLAYSESHQIRVSQQDYRLFRTLFLLMVSFFIMWSPIIITILLILIQNFRQDLVIWP
SLFFWVVAFTFANSALNPILYNMSLFRSEWRKIFCCFFFPEKGAIFTETSIRRNDLSVIS
T
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtcccctgagtgtgcgcagacgacgggccctggcccctcgcgcaccccggaccaagtc
aatcgcacccacttccctttcttctcggatgtcaagggcgaccaccggctggtgctgagc
gtcctggagaccaccgttctgggactcatctttgtggtctcactgctgggcaacgtgtgt
gccctggtgctggtggtgcgccgtcggcgccgtggggcgacagtcagcttggtgctcaac
ctcttctgcgcggatttgctcttcaccagcgccatccctctagtgctcgtggtgcgctgg
actgaagcctggctgctggggcccgtcgtctgccacctgctcttctacgtgatgaccatg
agcggcagcgtcacgatcctcacgctggccgcggtcagcctggagcgcatggtgtgcatc
gtgcgcctgcggcgcggcttgagcggcccggggcggcggactcaggcggcgctgctggct
ttcatatggggttactcggcgctcgccgcgctgcccctctgcatcttgttccgcgtggtc
ccgcagcgccttcccggcggggaccaggaaattccgatctgcacattggattggcccaac
cgcataggagaaatctcatgggatgtgttttttgtgactttgaacttcctggtaccagga
ctggtcattgtgatcagctactccaagattttacagatcacgaaagcctcgcggaagagg
cttacgctgagcttggcatactccgagagccaccagatccgagtgtcccagcaggactac
cggctcttccgaacgctcttcctgctcatggtttccttcttcatcatgtggagtcccatc
atcatcaccatcctcctcatcttgatccagaacttccggcaggacctggttatctggccg
tcccttttcttctgggtggtggccttcacgtttgccaactccgccctaaaccccattctg
tacaacatgtcgctgttcaggagcgagtggaggaagattttttgctgcttctttttccca
gagaagggagccatttttacagaaacgtctatcaggcgaaatgacttgtctgttatttcc
acctaa

DBGET integrated database retrieval system