KEGG   Rattus norvegicus (rat): 29411
Entry
29411             CDS       T01003                                 

Gene name
Ppt1
Definition
(RefSeq) palmitoyl-protein thioesterase 1 precursor
  KO
K01074  palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00062  Fatty acid elongation
rno01100  Metabolic pathways
rno01212  Fatty acid metabolism
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    29411 (Ppt1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    29411 (Ppt1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rno01004]
    29411 (Ppt1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     29411 (Ppt1)
Lipid biosynthesis proteins [BR:rno01004]
 Fatty acid synthase
  Component type
   29411 (Ppt1)
SSDB
Motif
Pfam: Palm_thioest Glyco_hydro_98M
Other DBs
NCBI-GeneID: 29411
NCBI-ProteinID: NP_071947
RGD: 61994
Ensembl: ENSRNOG00000012616
UniProt: P45479
Position
5
AA seq 306 aa
MASPGYRRLLAAALLPWCCAAWALGHLDPPSPPPLVIWHGMGDSCCNPMSMGSIKKMVEK
EIPGIYVLSLEIGKNMVEDVENSFFLNVNLQVGMACQILEKDPKLQHGYNAIGFSQGGQF
LRAVAQRCPTPPMMTLISVGGQHQGVFGLPRCPGESSHICDFIRKSLNAGAYSKVVQERL
VQAQYWHDPIKEEVYRNCSIFLADINQERHINESYKENLMALKKFVMVKFFNDSIVDPVD
SEWFGFYRSGQAKETIPLQETTLYTEDRLGLKKMDKAGKLVFLAKEGDHLQISKEWFTAH
IIPFLK
NT seq 921 nt   +upstreamnt  +downstreamnt
atggcgtcgcccggttaccggaggctgctagctgcggctctgcttccttggtgttgcgcc
gcctgggccctgggacatctggacccaccttctccaccaccgctggtgatctggcatggg
atgggggacagctgctgtaaccccatgagcatgggtagcattaaaaagatggttgaaaag
gaaataccagggatttacgtcctgtctctggagattgggaagaacatggtggaggatgtg
gagaacagcttcttcttgaatgtcaacctccaagtcggaatggcatgtcagattctggaa
aaggatcctaagttgcaacacggatacaatgctattggcttctcccagggaggccagttc
ctgagggcagtggctcagagatgcccaacacctcccatgatgaccctgatctcagttggg
ggacaacatcaaggtgtctttggactccctcgatgcccaggagagagttctcatatctgt
gacttcatcaggaagtcacttaacgctggtgcttactccaaagttgtgcaagaacgcctg
gtgcaagcacagtactggcatgaccccatcaaggaggaagtgtaccgaaactgcagcatc
ttcttggcagacataaatcaagagaggcatatcaatgagtcctacaaggagaacctgatg
gccctcaagaagtttgtgatggtgaaattctttaacgattccatcgtggaccctgtagac
tctgagtggtttggattttacagaagtggccaagctaaggaaaccattcccctccaggag
accactctctacacagaggaccgcctggggctaaagaaaatggacaaagcaggaaagcta
gtgtttctggctaaggaaggagaccaccttcaaatatctaaagagtggtttacagcccac
atcataccttttcttaagtga

KEGG   Rattus norvegicus (rat): 54398
Entry
54398             CDS       T01003                                 

Gene name
Ppt2
Definition
(RefSeq) lysosomal thioesterase PPT2 precursor
  KO
K01074  palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00062  Fatty acid elongation
rno01100  Metabolic pathways
rno01212  Fatty acid metabolism
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    54398 (Ppt2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    54398 (Ppt2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rno01004]
    54398 (Ppt2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     54398 (Ppt2)
Lipid biosynthesis proteins [BR:rno01004]
 Fatty acid synthase
  Component type
   54398 (Ppt2)
SSDB
Motif
Pfam: Palm_thioest Abhydrolase_1 Abhydrolase_6 DUF676 PGAP1 Lipase_2 Hydrolase_4
Other DBs
NCBI-GeneID: 54398
NCBI-ProteinID: NP_062240
RGD: 620375
Ensembl: ENSRNOG00000000435
Vega: OTTRNOG00000001705
UniProt: O70489
Position
20
AA seq 302 aa
MPGLWRQRLPSAWALLLLPFLPLLLPAAPAPHRGSYKPVIVVHGLFDSSYSFRHLLDYIN
ETHPGTVVTVLDLFDGRESLRPLWEQVQGFREAVVPIMEKAPEGVHLICYSQGGLVCRAL
LSVMDEHNVDSFISLSSPQMGQYGDTDYLKWLFPTSMRSNLYRICYSPWGQEFSICNYWH
DPHHDDLYLNASSFLALINGERDHPNATAWRKNFLRVGRLVLIGGPDDGVITPWQSSFFG
FYDANETVLEMEEQPVYLRDSFGLKTLLARGAIVRCPMAGVSHTTWHSNRTLYDACIEPW
LS
NT seq 909 nt   +upstreamnt  +downstreamnt
atgccggggctatggaggcagaggcttccttcggcttgggctttgcttctcctgcctttc
ctgccgctgctgttgcccgcagcccccgcaccccaccgcgggtcctacaagccagtgatc
gtggtgcatgggctctttgacagttcatacagcttccgccacctgctggactacatcaat
gagacacaccccgggactgtggtgacagtgcttgatctcttcgatggcagagagagcttg
cgacccctgtgggaacaggttcaagggttccgagaggctgtggtccccatcatggaaaag
gcccctgagggggtacacctcatctgctactcccagggaggcctggtgtgccgcgcattg
ctgtctgtcatggatgagcacaatgtggattccttcatctccctttcttctccacagatg
ggacagtatggagacacggactatttgaagtggctgttccctacgtccatgcggtctaac
ctctatcggatctgctatagcccctggggccaggaattttccatttgcaactactggcac
gaccctcaccacgatgacttgtacctcaacgccagcagctttctggccctcatcaatggg
gagagagaccatccgaatgccactgcatggcggaagaacttccttcgtgtgggccgtctg
gtgctgattgggggtccggacgatggagtcatcactccctggcaatctagcttctttggt
ttctatgatgccaacgagacggtcttggagatggaggaacagccggtgtatcttcgagac
tcttttgggttgaagactctcttggcccggggggccatagtgagatgccccatggctggg
gtctctcacaccacctggcactccaatcgcacgctctatgacgcttgcattgagccctgg
ctctcctga

DBGET integrated database retrieval system