KEGG   Rattus norvegicus (rat): 29412Help
Entry
29412             CDS       T01003                                 

Gene name
Adra1a, Adra1c
Definition
(RefSeq) adrenoceptor alpha 1A
  KO
K04135  adrenergic receptor alpha-1A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04152  AMPK signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04270  Vascular smooth muscle contraction
rno04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    29412 (Adra1a)
   04022 cGMP-PKG signaling pathway
    29412 (Adra1a)
   04152 AMPK signaling pathway
    29412 (Adra1a)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    29412 (Adra1a)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    29412 (Adra1a)
   04270 Vascular smooth muscle contraction
    29412 (Adra1a)
  09154 Digestive system
   04970 Salivary secretion
    29412 (Adra1a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    29412 (Adra1a)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    29412 (Adra1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 29412
NCBI-ProteinID: NP_058887
RGD: 2055
Ensembl: ENSRNOG00000009522
UniProt: P43140
Position
15p12
AA seq 466 aa AA seqDB search
MVLLSENASEGSNCTHPPAPVNISKAILLGVILGGLIIFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNIWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQRRGVRALLCVWVLSLVISIGPLFGWRQPAPEDETICQINE
EPGYVLFSALGSFYVPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
VPAEGGGVSSAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD
FKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLRRRQSSKHALGYTL
HPPSQALEGQHRDMVRIPVGSGETFYKISKTDGVCEWKFFSSMPQGSARITVPKDQSACT
TARVRSKSFLQVCCCVGSSAPRPEENHQVPTIKIHTISLGENGEEV
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggtgcttctctctgaaaatgcttcggaaggctccaactgcacccacccaccagctccg
gtgaacatttctaaggccattctgcttggggtgatcttggggggcctcatcattttcgga
gtcctggggaacattttagtgatcctctcagtggcctgtcatcggcatctgcactccgtg
actcactactacattgtcaacctggctgtggcagacctcctcctcacctccactgtgctg
cccttctctgccatctttgagatcctgggctactgggcctttggcagggtgttctgcaat
atctgggcggccgtggacgtcttatgctgcacagcgtccatcatgggcctctgcatcatc
tccatcgaccgatacattggtgtgagctacccgctgcgctatcccaccattgtcacccag
aggaggggcgtcagggctctgctctgcgtctgggtgctttctttggtcatctccatcgga
cccctgttcggctggaggcagccggctccagaggatgagaccatctgccagatcaatgag
gagccgggctacgtgctgttctcagcgctgggctctttctacgtgccactggccatcatt
ctggttatgtactgtcgagtctacgtagtagccaagagagaaagccggggcctcaagtcc
ggcctcaagacggacaagtcagactcagagcaagtgacgctccgcatccaccgtaaaaat
gtccctgcagaaggcggcggagtcagcagtgccaagaataagactcacttctcagtgagg
ctgctcaagttttctcgagagaagaaagctgccaagacgctgggcatcgtggtgggttgc
ttcgtcctctgctggctgccgttcttcctagtgatgcccattgggtctttcttcccggat
ttcaagccttcggaaaccgtttttaaaatagtattttggctcgggtatctaaatagttgc
atcaaccctatcatatacccatgctccagccaggagttcaagaaagcctttcagaatgtc
ctgcgaatccagtgtcttcgcagaaggcagtcttccaagcatgccctgggctataccctg
cacccgcccagccaggctctagagggacagcacagagacatggtgcgtatcccggtgggc
tcgggagagactttctataagatctccaagacagatggagtctgtgaatggaagtttttc
tcttccatgccccagggatcggccaggattacagtgccaaaggaccaatctgcctgtacc
acagcccgggtgagaagtaaaagctttttgcaggtctgctgctgtgtggggtcctcggcc
ccgcgccctgaagaaaatcaccaagttccaaccattaagatccacaccatctccctcggt
gaaaacggggaggaagtctag

DBGET integrated database retrieval system