KEGG   Rattus norvegicus (rat): 29412Help
Entry
29412             CDS       T01003                                 

Gene name
Adra1a, Adra1c
Definition
(RefSeq) adrenoceptor alpha 1A
  KO
K04135  adrenergic receptor alpha-1A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04152  AMPK signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04270  Vascular smooth muscle contraction
rno04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    29412 (Adra1a)
   04022 cGMP - PKG signaling pathway
    29412 (Adra1a)
   04152 AMPK signaling pathway
    29412 (Adra1a)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    29412 (Adra1a)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    29412 (Adra1a)
   04270 Vascular smooth muscle contraction
    29412 (Adra1a)
  Digestive system
   04970 Salivary secretion
    29412 (Adra1a)
G protein-coupled receptors [BR:rno04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Adrenaline [OT]
    29412 (Adra1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 29412
NCBI-ProteinID: NP_058887
RGD: 2055
Ensembl: ENSRNOG00000009522
UniProt: P43140
Position
15p12
AA seq 466 aa AA seqDB search
MVLLSENASEGSNCTHPPAPVNISKAILLGVILGGLIIFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNIWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQRRGVRALLCVWVLSLVISIGPLFGWRQPAPEDETICQINE
EPGYVLFSALGSFYVPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
VPAEGGGVSSAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD
FKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLRRRQSSKHALGYTL
HPPSQALEGQHRDMVRIPVGSGETFYKISKTDGVCEWKFFSSMPQGSARITVPKDQSACT
TARVRSKSFLQVCCCVGSSAPRPEENHQVPTIKIHTISLGENGEEV
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggtgcttctctctgaaaatgcttcggaaggctccaactgcacccacccaccagctccg
gtgaacatttctaaggccattctgcttggggtgatcttggggggcctcatcattttcgga
gtcctggggaacattttagtgatcctctcagtggcctgtcatcggcatctgcactccgtg
actcactactacattgtcaacctggctgtggcagacctcctcctcacctccactgtgctg
cccttctctgccatctttgagatcctgggctactgggcctttggcagggtgttctgcaat
atctgggcggccgtggacgtcttatgctgcacagcgtccatcatgggcctctgcatcatc
tccatcgaccgatacattggtgtgagctacccgctgcgctatcccaccattgtcacccag
aggaggggcgtcagggctctgctctgcgtctgggtgctttctttggtcatctccatcgga
cccctgttcggctggaggcagccggctccagaggatgagaccatctgccagatcaatgag
gagccgggctacgtgctgttctcagcgctgggctctttctacgtgccactggccatcatt
ctggttatgtactgtcgagtctacgtagtagccaagagagaaagccggggcctcaagtcc
ggcctcaagacggacaagtcagactcagagcaagtgacgctccgcatccaccgtaaaaat
gtccctgcagaaggcggcggagtcagcagtgccaagaataagactcacttctcagtgagg
ctgctcaagttttctcgagagaagaaagctgccaagacgctgggcatcgtggtgggttgc
ttcgtcctctgctggctgccgttcttcctagtgatgcccattgggtctttcttcccggat
ttcaagccttcggaaaccgtttttaaaatagtattttggctcgggtatctaaatagttgc
atcaaccctatcatatacccatgctccagccaggagttcaagaaagcctttcagaatgtc
ctgcgaatccagtgtcttcgcagaaggcagtcttccaagcatgccctgggctataccctg
cacccgcccagccaggctctagagggacagcacagagacatggtgcgtatcccggtgggc
tcgggagagactttctataagatctccaagacagatggagtctgtgaatggaagtttttc
tcttccatgccccagggatcggccaggattacagtgccaaaggaccaatctgcctgtacc
acagcccgggtgagaagtaaaagctttttgcaggtctgctgctgtgtggggtcctcggcc
ccgcgccctgaagaaaatcaccaagttccaaccattaagatccacaccatctccctcggt
gaaaacggggaggaagtctag

DBGET integrated database retrieval system