KEGG   Rattus norvegicus (rat): 294126
Entry
294126            CDS       T01003                                 

Gene name
Taar7b
Definition
(RefSeq) trace amine-associated receptor 7b
  KO
K05051  trace amine associated receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    294126 (Taar7b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    294126 (Taar7b)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Biogenic amine
   Trace amine
    294126 (Taar7b)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4 Ninjurin
Other DBs
NCBI-GeneID: 294126
NCBI-ProteinID: NP_783176
RGD: 631392
Ensembl: ENSRNOG00000046302
UniProt: Q923X8
Position
1
AA seq 358 aa
MATDDDRFPWDQDSILSRDLLSASSMQLCYEKLNRSCVRSPYSPGPRLILYAVFGFGAVL
AVCGNLLVMTSILHFRQLHSPANFLVASLACADFLVGLTVMPFSMVRSVEGCWYFGDIYC
KFHSSFDGSFCYSSIFHLCFISADRYIAVSDPLIYPTRFTASVSGKCITFSWLLSIIYSF
SLFYTGVNEAGLEDLVSALTCVGGCQIAVNQSWVFINFLLFLVPALVMMTVYSKIFLIAK
QQAQNIEKMGKQTARASESYKDRVAKRERKAAKTLGIAVAAFLLSWLPYFIDSIIDAFLG
FVTPTYVYEILVWIGYYNSAMNPLIYAFFYPWFRKAIKLIVTGKILRENSSATNLFPE
NT seq 1077 nt   +upstreamnt  +downstreamnt
atggctacagatgatgaccgctttccctgggatcaggacagcatcctgagcagagatctg
ctctcagcctcatctatgcagctgtgctatgagaaactgaacagatcctgtgtcaggagc
ccatactccccaggccctcgcctcatcctttatgcagtctttggctttggggctgtgctg
gctgtgtgtggaaacctcctggtgatgacatcaattcttcatttcaggcagctgcactct
cctgccaactttctggtggcctccctggcctgtgctgacttcttggtgggtctgactgtg
atgcctttcagcatggtgaggtctgtggagggctgctggtactttggagacatttattgt
aaattccattcttcttttgatgggtcattctgctattcttctatattccacttgtgtttc
atctctgctgatagatacattgcagtcagtgaccccctgatctaccccaccaggttcact
gcatctgtttctggcaagtgtatcaccttctcctggctcctgtccatcatctacagcttt
tcccttttttacacaggggtcaatgaagctgggctggaggatctagtgagtgccctcacc
tgtgtgggtggatgtcaaatcgcagtgaatcaaagctgggtcttcatcaatttcctattg
tttcttgtccctgcgcttgtgatgatgactgtctactctaagatcttcctcattgcaaag
cagcaggctcagaacattgagaagatgggcaagcagaccgccagggcatctgaaagctac
aaggacagggtggccaagagggagaggaaagcagccaaaaccctgggcatcgcagtggct
gccttcctcctttcatggctgccatacttcattgactccatcattgacgccttccttggg
tttgtcacgcccacgtatgtgtatgaaatcctagtttggataggttactataactcagcc
atgaaccctttgatttatgctttcttttatccttggtttcgaaaagccatcaaactcatt
gtcactggcaaaatcttgagagagaattcttcagccaccaacctgtttcctgagtag

DBGET integrated database retrieval system