KEGG   Rattus norvegicus (rat): 29413Help
Entry
29413             CDS       T01003                                 

Gene name
Adra1d, Adrd1
Definition
(RefSeq) adrenoceptor alpha 1D
  KO
K04137  adrenergic receptor alpha-1D
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04261  Adrenergic signaling in cardiomyocytes
rno04270  Vascular smooth muscle contraction
rno04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    29413 (Adra1d)
   04022 cGMP-PKG signaling pathway
    29413 (Adra1d)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    29413 (Adra1d)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    29413 (Adra1d)
   04270 Vascular smooth muscle contraction
    29413 (Adra1d)
  09154 Digestive system
   04970 Salivary secretion
    29413 (Adra1d)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    29413 (Adra1d)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    29413 (Adra1d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 29413
NCBI-ProteinID: NP_077809
RGD: 62064
Ensembl: ENSRNOG00000021256
UniProt: P23944
Position
3q36
AA seq 561 aa AA seqDB search
MTFRDILSVTFEGPRSSSSTGGSGAGGGAGTVGPEGGAVGGVPGATGGGAVVGTGSGEDN
QSSTGEPGAAASGEVNGSAAVGGLVVSAQGVGVGVFLAAFILTAVAGNLLVILSVACNRH
LQTVTNYFIVNLAVADLLLSAAVLPFSATMEVLGFWAFGRTFCDVWAAVDVLCCTASILS
LCTISVDRYVGVRHSLKYPAIMTERKAAAILALLWAVALVVSVGPLLGWKEPVPPDERFC
GITEEVGYAIFSSVCSFYLPMAVIVVMYCRVYVVARSTTRSLEAGIKREPGKASEVVLRI
HCRGAATSAKGYPGTQSSKGHTLRSSLSVRLLKFSREKKAAKTLAIVVGVFVLCWFPFFF
VLPLGSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCSSREFKRAFLRLLRCQCRRRRR
RLWAVYGHHWRASTGDARSDCAPSPRIAPPGAPLALTAHPGAGSADTPETQDSVSSSRKP
ASALREWRLLGPLQRPTTQLRAKVSSLSHKIRSGARRAETACALRSEVEAVSLNVPQDGA
EAVICQAYEPGDYSNLRETDI
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgactttccgcgacatcctgagcgtcactttcgaaggaccccggtcgagcagtagcact
gggggctccggcgcgggcggcggagctggcacggttggccccgagggtggggcggtgggc
ggcgtgccgggcgctacaggcggcggcgctgtggtgggaaccggcagcggcgaggacaac
cagagctccacgggagaaccgggagccgcggcgagcggcgaagtaaatggctcggcggcc
gtcggggggctagtggtgagtgctcagggcgtgggagtgggtgtcttcctggcggccttc
atcctcaccgctgtggcgggcaacctgctggtcatcctttcggtggcctgcaaccgccac
ctacagacggtcaccaactatttcatcgtgaacctggcggtggctgacctgcttttgagt
gcagctgtgttgcccttctcagccactatggaggttctaggcttctgggccttcggccga
accttctgcgacgtgtgggccgcggtggacgtgctgtgctgcactgcctccatccttagc
ctctgcaccatctctgtggaccggtacgtgggtgtgcgccactcgctcaagtacccagcc
attatgacagagcgcaaggccgctgccattctggctctgctttgggcggtggccctggtg
gtatctgtgggaccgctactaggttggaaggagccagtgcccccggatgagcgtttctgc
ggcatcaccgaggaggtgggctatgcaatcttctcttccgtgtgctccttctacctaccc
atggcagtgatcgtggtcatgtactgccgcgtgtacgtggtcgcacgcagcactacgcgc
agcctcgaggcaggcatcaagagggagcccggcaaggcctccgaggtggttctgaggatc
cactgtcgcggcgcagcgaccagcgccaaaggatatcccggaacacagagtagcaagggc
cacaccttgcgcagctcgctttccgtgaggctgctcaagttttcccgcgagaaaaaggct
gccaagacgttggccatcgtcgtgggtgtcttcgtcctgtgctggttccccttcttcttc
gtcctgcctctgggctctctgttcccgcagctgaaaccgtcagagggtgtcttcaaggtc
atcttctggctgggctacttcaatagctgtgtgaacccgctcatctacccctgctccagt
cgcgagttcaagcgcgccttcctccgcctcctgcgctgccagtgtcgccgccgccgccgc
cgcctctgggcagtctacggccaccactggcgagcctcgaccggcgacgcgcgttccgac
tgcgcccccagccctcgcatcgctccccccggggcccctctagccctcactgcacacccg
ggtgcgggctcggcagacacgccggagacgcaggattcggtctccagcagtcgaaagcca
gcctccgccctccgggagtggagactgctcgggccgctacagagacccacgacccagctg
cgtgcgaaggtgtccagcctgtcccataagattcgctctggggcccggcgcgcggagact
gcgtgtgccctgcgctccgaggtagaagcagtgtccctaaatgttccccaagatggggca
gaagctgtcatctgccaggcttatgagccgggcgactacagcaacctccgagagactgac
atttaa

DBGET integrated database retrieval system