KEGG   Rattus norvegicus (rat): 294140Help
Entry
294140            CDS       T01003                                 

Gene name
Olr1668
Definition
(RefSeq) olfactory receptor 1668
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    294140 (Olr1668)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    294140 (Olr1668)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    294140 (Olr1668)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srv 7TM_GPCR_Srx 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 294140
NCBI-ProteinID: NP_001000267
RGD: 1332634
Ensembl: ENSRNOG00000053746
UniProt: A0A0G2JY37
Position
20p12
AA seq 312 aa AA seqDB search
MAVSNESHPKEFILLGFADHPWLELPLFVTLLITYPMALMGNIAIILVSTLDPRLHSPMY
FFLRNLSFLDMCYTTSVVPQMLFNLGSSRKTISYVGCVIQLYIFHVMGGTECLLLAIMSI
DRYVAICRPLHYTLIMSQRVCVLSVSIMWLTGVIFGFSEATLTLQLPLCGQYKLDHLLCE
IPVLIKTACGEKEFNELALSVVCIFILIVPLFLILASYVNIGRAVLRIKSSEGRRKAFGT
CSSHLIVVSLFYGPGMSMYLQPPSSITRDQPKFMALFYAVITPTLNPFIYTLRNKDVKGA
LKKLLRSIFSSK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggctgtatccaatgaaagccacccgaaagaattcatcctcctgggctttgctgaccac
ccttggctggaactcccgctctttgttactctgctgatcacgtaccccatggctttgatg
gggaacatcgccatcattctggtgtccaccttggatcctcgtctccacagccccatgtat
ttttttctcagaaatctctcctttctggacatgtgctacaccacaagcgttgtgcctcag
atgctgtttaacctgggaagctccagaaaaaccatcagttacgttggatgtgttatccaa
ctttatatcttccacgtaatgggtggcacggaatgtctgcttttggctatcatgtccatt
gatcgctacgtggctatctgcagacctctccactacaccctcatcatgagtcagcgagtg
tgcgtcttgtcagtgtctattatgtggctgactggagtgatctttggtttttcagaggct
acacttacattacaattgccattgtgtggccaatataaactggatcacttattgtgtgaa
atccccgttctcataaaaactgcctgtggggagaaggagtttaatgagctggcactttct
gtggtgtgcattttcatactgattgttcctctgttcttaattcttgcttcttatgttaat
attggtcgtgcagtacttagaattaaatcttctgaaggaaggaggaaagcctttgggaca
tgttcttctcatctcattgtagtttctttattttatggtccaggcatgagcatgtacctt
cagcctccttcctccatcacaagggaccaacccaagttcatggctctcttttatgcagtg
ataactcctacactgaaccccttcatctataccctaaggaacaaggatgtaaagggtgcc
ttaaaaaagctactgagaagcatttttagttcaaagtga

DBGET integrated database retrieval system