KEGG   Rattus norvegicus (rat): 294159Help
Entry
294159            CDS       T01003                                 

Gene name
Olr1695, ratchr20-679277-678312_ORF
Definition
(RefSeq) olfactory receptor 1695
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    294159 (Olr1695)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    294159 (Olr1695)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    294159 (Olr1695)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7TM_GPCR_Srbc 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 294159
NCBI-ProteinID: NP_001000272
RGD: 1333191
Ensembl: ENSRNOG00000000746
UniProt: D4ACX6
Position
20p12
AA seq 321 aa AA seqDB search
MINSSVNSDFILVGFSDQPQLEKRLFIVVLISYLLTLVGNTIIILISSIDSKLKTPMYYF
LTHLSFVDICFTTSIVPQLLWNLKGPAKTITAVGCVVQLYVSLTLGSTECILLAVMAFDR
YAAVCKPLHYVAVMNPQLCQALAGISWLSGVGNALIQGTITLWLPRCGHRWLHHFFCEVP
SMIKLACVDIHANEVQLFVASLVLLLLPLALILTSYGHIAKEVLRIKSSQAWHRALGTCG
SHLMVVSLFYGSITVIYIQPNSSYAHTHGKFISLFYTVMTPTLNPLIYTLRNKEVKGALE
RLFSRAAGVCKQNRARGDRTL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgattaacagcagtgtcaatagcgatttcattctggtgggtttttcggatcagcctcag
ctggagaaaagactctttatagtagttttaatttcctatcttctcactctggtgggaaat
acgatcattattctgatctcttcaatagattccaaactcaaaacccctatgtactatttt
ctaactcacctctccttcgttgacatctgcttcaccaccagtattgtcccccaactgcta
tggaacctgaaaggaccagccaagactatcacagctgtgggctgtgtggtgcagctttat
gtctctctgactctgggctctactgaatgtattctcctggcagtaatggcttttgatcgc
tatgctgctgtctgtaaacctctccactacgtagctgtgatgaatcctcagctctgccag
gctctagcaggaatctcatggctcagtggagtaggaaatgctctcatccaaggaacaatc
actctttggctcccacgttgtggccaccggtggctccaccatttcttctgtgaggtcccc
tccatgatcaagcttgcctgtgtggacattcatgccaatgaggtccaactctttgtagcc
tcattggtcttgctgctcttacccttagcactgatactgacatcctatggacatatagcc
aaggaagttttaagaattaagtcatcccaggcttggcacagagccctgggcacatgtgga
tcccacttgatggtggtatccctcttctacgggagcatcacagtcatctacatccagcca
aacagttcatacgcccatacccatgggaagttcatctctctcttttacactgttatgacc
ccaacccttaatcctctcatctacacgctgaggaataaagaggtgaaaggggctcttgaa
aggctcttcagtagagccgctggagtatgcaaacaaaacagagcacgtggtgacaggact
ttatga

DBGET integrated database retrieval system