KEGG   Rattus norvegicus (rat): 29416Help
Entry
29416             CDS       T01003                                 

Gene name
Aadat, Kat2
Definition
(RefSeq) aminoadipate aminotransferase
  KO
K00825  kynurenine/2-aminoadipate aminotransferase [EC:2.6.1.7 2.6.1.39]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00310  Lysine degradation
rno00380  Tryptophan metabolism
rno01100  Metabolic pathways
rno01210  2-Oxocarboxylic acid metabolism
Module
rno_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    29416 (Aadat)
   00310 Lysine degradation
    29416 (Aadat)
   00380 Tryptophan metabolism
    29416 (Aadat)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rno01007]
    29416 (Aadat)
Enzymes [BR:rno01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.7  kynurenine---oxoglutarate transaminase
     29416 (Aadat)
    2.6.1.39  2-aminoadipate transaminase
     29416 (Aadat)
Amino acid related enzymes [BR:rno01007]
 Aminotransferase (transaminase)
  Class I
   29416 (Aadat)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_MocR
Motif
Other DBs
NCBI-GeneID: 29416
NCBI-ProteinID: NP_058889
RGD: 2948
Ensembl: ENSRNOG00000011861
UniProt: Q64602
Position
16p12
AA seq 425 aa AA seqDB search
MNYSRFLTATSLARKTSPIRATVEIMSRAPKDIISLAPGSPNPKVFPFKSAVFTVENGST
IRFEGEMFQRALQYSSSYGIPELLSWLKQLQIKLHNPPTVNYSPNEGQMDLCITSGCQDG
LCKVFEMLINPGDTVLVNEPLYSGALFAMKPLGCNFISVPSDDCGIIPEGLKKVLSQWKP
EDSKDPTKRTPKFLYTIPNGNNPTGNSLTGDRKKEIYELARKYDFLIIEDDPYYFLQFTK
PWEPTFLSMDVDGRVIRADSLSKVISSGLRVGFITGPKSLIQRIVLHTQISSLHPCTLSQ
LMISELLYQWGEEGFLAHVDRAIDFYKNQRDFILAAADKWLRGLAEWHVPKAGMFLWIKV
NGISDAKKLIEEKAIEREILLVPGNSFFVDNSAPSSFFRASFSQVTPAQMDLVFQRLAQL
IKDVS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaattactcaaggttcctcactgcaacgagcctggccagaaagacatcccctatcaga
gctacagtggagataatgagtagagcacccaaagacatcatctccctggctcctggatct
ccgaacccgaaagtgttcccctttaagtcagctgtcttcactgtggagaacggaagcacc
atccggtttgaaggagagatgtttcaaagggccctccaatattcctcaagctatggaatt
ccagaacttctgtcctggctaaaacagttgcaaataaaattgcataatcctccgactgtc
aactactcacccaacgaaggacagatggacctctgcatcacatctggctgtcaagacggt
ctctgtaaggtgtttgaaatgctcatcaatcctggagacactgttctggtcaatgaacca
ctgtattcaggagccctttttgcaatgaaaccactgggctgcaattttattagtgtcccc
agtgatgactgtgggattattccagagggtctcaaaaaagtactttcccagtggaaacca
gaagattccaaggatcccacaaaaaggactccaaaatttctgtatactattccgaatggc
aacaaccctacaggcaactcgttgactggtgaccgcaagaaagaaatctatgagcttgca
agaaaatatgacttcctcataatagaagacgatccttactattttctccagttcaccaag
ccttgggaaccaacctttctctccatggatgttgatgggagagttatcagagctgactcc
ctttcaaaagttatctcctcagggctgagagtggggtttataactggccccaagtccttg
atacagaggattgttctccacacacaaatctcatcactgcatccctgtactttatcacag
ctcatgatatcggagcttctataccagtggggagaagagggtttcctggcccatgttgac
agagctattgatttctacaagaaccagagggattttatattggcagctgcagacaagtgg
ttacgtggtttggcagagtggcatgttcccaaagctggcatgtttctatggattaaagtt
aacggaatctctgatgcaaaaaaactaattgaagaaaaggctattgaaagagagatcttg
ttagttcctggaaatagtttcttcgtcgataattcagccccctcctccttcttcagagca
tccttctctcaggttactccagcgcagatggacttagtcttccagagattggcccaactc
ataaaagacgtttcataa

DBGET integrated database retrieval system