KEGG   Rattus norvegicus (rat): 294161Help
Entry
294161            CDS       T01003                                 

Gene name
Olr1691
Definition
(RefSeq) olfactory receptor 1691
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    294161 (Olr1691)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    294161 (Olr1691)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    294161 (Olr1691)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 294161
NCBI-ProteinID: NP_001000273
RGD: 1332763
Ensembl: ENSRNOG00000047094
UniProt: D4A2D1
Position
20p12
AA seq 323 aa AA seqDB search
MTARNITTMSGFLLMGFSDNHELQVLQALLFLVTYLLGTAGNFIIITITTLDPKLQSPMY
YFLKHLSILDLSSLSVTVPQYVYSSLAQSGYISFGQCVMQVFFFTALAWTEMAILTVMSY
DRYVAICLPLHYEVIMSPRKCTWAVAAVWLSGSITGTLYTASILSIRFCGDKIIHQFFCD
VPQLLKISCSNDYVGVQKVSTFMTLLAFACFMGIAFSYGQIFSTVLRIPSAESQTKVFST
CLPHLFVVSFFLSTGICAYLKPTSDSPTALDFILSIFYTVLPPTLNPVIYSLRNESFKGA
VKKLLLSEEFIGKNYICSVVRAC
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaagaaacataaccacaatgagtggatttctcctaatggggttctctgacaac
catgagctgcaggtcttacaagctttactcttcttggtgacatacctattagggacagca
ggtaacttcatcattatcaccatcacaacactggacccaaagctccagtctccaatgtat
tactttctgaaacacctttccattctggacctctcatctctctctgtcacagttccccag
tatgtttatagttcactggcacaaagtggctacatatcatttggccagtgcgtgatgcag
gtttttttcttcacagctttggcctggactgagatggccattctcacagtgatgtcttat
gaccgctatgtggccatctgcctcccactgcactatgaggtcatcatgagtcccagaaag
tgcacttgggctgtggcagctgtgtggctcagtggaagcatcacaggaacattatacaca
gcaagtatactctctatcagattctgtggggacaagataattcaccagttcttctgtgat
gtcccccagttgctcaagatctcttgctctaatgattacgttggagtacagaaagtgtct
actttcatgactttattggcctttgcctgcttcatggggattgccttctcctatggccag
atattctctacagttctcaggattccctctgcagaaagtcaaactaaggtcttctcgaca
tgcctgccccatctctttgttgtttcattttttctctcaacaggcatttgtgcctatcta
aagccaacctcagactcaccaactgctttagacttcatactctctattttttacactgta
ctacccccaaccctcaaccccgttatctatagtctaagaaatgagtcctttaagggagct
gtaaagaagttactgttaagtgaagaattcattgggaaaaattatatttgttctgttgtt
cgtgcctgctga

DBGET integrated database retrieval system