KEGG   Rattus norvegicus (rat): 29417Help
Entry
29417             CDS       T01003                                 

Gene name
Men1, menin
Definition
(RefSeq) menin 1
  KO
K14970  menin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04934  Cushing syndrome
rno05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    29417 (Men1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    29417 (Men1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    29417 (Men1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   HMT complexes
    MLL-HCF complex
     29417 (Men1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Menin
Motif
Other DBs
NCBI-GeneID: 29417
NCBI-ProteinID: NP_062081
RGD: 3078
Ensembl: ENSRNOG00000021054
UniProt: Q9WVR8
Position
1q43
AA seq 610 aa AA seqDB search
MGLKAAQKTLFPLRSIDDVVRLFAAELGREEPDLVLLSLVLGFVEHFLAVNRVIPTNVPE
LTFQPSPAPDPPGGLTYFPVADLSIIAALYARFTAQIRGAVDLSLYPREGGVSSRELVKK
VSDVIWNSLSRSYFKDRAHIQSLFSFITGTKLDSSGVAFAVVGACQALGLRDVHLALSED
HAWVVFGSNGEQTAEVTWHGKGNEDRRGQTVNAGVAERSWLYLKGSYMRCDRKMEVAFMV
CAINPSIDLHTDSLELLQLQQKLLWLLYDLGHLERYPMALGNLADLEELEPTPGRPDPLT
LYHKGIASAKTYYQDEHIYPYMYLAGYHCRNRNVREALQAWADTATVIQDYNYCREDEEI
YKEFFEVANDVIPNLLKEAASLLEAGEERPGEQAQGTQGQGSALQDPECFAHLLRFYDGI
CKWEEGSPTPVLHVGWATFLVQSLGRFEGQVRQKVHIVSREAEAAEAEEPWGDEAREGRR
RGPRRESKPEEPPPPKKPALDKGPGSGQSAGSGPPRKTSGTVSGTARGTEVSSAAQAPAP
AASPPPEGPVLTFQSEKMKGMKELLVATKINSSAIKLQLTAQSQVQMKKQKVSTPSDYTL
SFLKRQRKGL
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atggggctgaaggccgcccagaagacgctgttccctctgcgctctatcgacgacgtggtg
cgcctgttcgctgcggagctgggccgagaggagcctgacctggtgctcctctccttggtt
ctgggcttcgtagagcatttcctggctgtcaaccgtgtcatccccaccaacgtgccggag
ctcaccttccagcccagcccggcacccgaccctcctggtggcctcacctacttcccagtg
gccgacctatccatcattgctgccctctatgcccgattcaccgctcagatccgcggtgct
gtggacctctccctctatcctcgagaggggggcgtttccagtcgcgaactggtaaaaaag
gtctcggatgtcatatggaacagcctcagccgctcctacttcaaggaccgggcccacatc
cagtctctcttcagcttcatcacaggcactaaactggacagttcgggcgtggcctttgca
gtggtaggggcctgccaggctctaggtctcagagatgtccatctggccctgtccgaggat
catgcctgggtggtgttcgggtccaatggggaacagacggctgaggtgacctggcatggc
aaaggcaacgaggaccgcagaggccagacagtcaacgctggtgtggctgagcggagctgg
ctgtacctgaaaggatcgtacatgcgctgtgaccgcaagatggaggtggcgttcatggtg
tgtgccatcaacccttccattgatcttcacactgactctttggaactgttgcaactacag
cagaagctgctctggctgctgtatgacctaggacatctggaaaggtaccccatggcgcta
gggaacttggcagacctggaggagctggaacccacccctggtcggccagacccgctcacc
ctctatcacaaggggattgcctcagctaagacctactaccaggatgaacacatctacccc
tacatgtacctggctggataccattgtcgcaaccgcaatgtgcgtgaagccctgcaggcc
tgggccgacactgccactgttatccaagactacaactactgtcgggaggatgaagagatc
tacaaggaattctttgaagtggccaatgacgtcatccccaacctgctgaaggaggcagcc
agcctgctagaagcaggcgaggagcggccaggagagcaagcccagggcacccaaggccaa
ggttctgccctccaggacccagagtgctttgcccacctgctgcgattctatgatggcatc
tgcaaatgggaggagggtagccccacaccagtactgcacgtgggctgggcaactttcctt
gtgcagtccctaggacgctttgagggacaggtgcggcagaaggtgcacatagttagccgg
gaagccgaggcagcagaggcggaagaaccatggggggacgaagcccgagaaggtcgtcgg
cgcggtccccgccgagagtccaagcctgaggagccaccaccacccaagaagcctgcgttg
gacaagggcccaggctcagggcaaagtgcagggtcgggacctcctaggaaaacgtcaggg
actgtctcaggtactgcccgtggcacagaagtcagcagtgctgctcaggctccagcacct
gcagcatcgccacccccagagggcccagtgctcactttccagagtgagaagatgaaagga
atgaaggagctactggtggccaccaagatcaactctagtgccatcaagctgcaactcacg
gcacagtcccaagtgcagatgaagaaacagaaggtgtccacacccagcgactacacactc
tctttcctaaagcggcagcgcaagggcctctga

DBGET integrated database retrieval system