KEGG   Rattus norvegicus (rat): 294183Help
Entry
294183            CDS       T01003                                 

Gene name
Olr1724
Definition
(RefSeq) olfactory receptor 1724
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    294183 (Olr1724)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    294183 (Olr1724)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    294183 (Olr1724)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv
Motif
Other DBs
NCBI-GeneID: 294183
NCBI-ProteinID: NP_001000277
RGD: 1334019
Position
20p12
AA seq 309 aa AA seqDB search
MNCTQAPGFILLGLSRDPEKWQLFFSIFLALYLLGLLGNLLLLLAIGADIHLHTPMYFFL
SQLSLVDLCFITTTAPKMLQALWTGDGSISFSGCLTQFYFFAVFADMDNLLLAVMAIDRY
AAICHPLLYPLLMTPCRCEVLASGSWGVAHCVSLFYTLLLSQLYFQTNEGIPHFFCDSRP
LLLLSCSDNHLNEGLMMGLSAVMGISALFCILSSYASIFHAVARVPSAQGKRKALATCSS
HFSVVLLFHSTVFATYLKPPSTSHSSGEVVAAVLYTLVTPTLNPFIYSLRNRDVKSSLRR
ILNIEKSQD
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaactgcactcaggctcctggctttatcctcttgggactatccagggacccagagaaa
tggcagctcttctttagcatcttccttgctctctacttgctgggccttttagggaacctg
ctccttctgttagctattggtgctgatatccacctccacacccccatgtatttcttcctc
agtcagctctcacttgtggatctttgcttcatcaccaccacagcccccaaaatgctgcag
gctctgtggactggagatggatccatttcattctctggatgcctgactcagttttacttc
tttgctgtttttgctgacatggataacctgcttcttgcagtcatggctattgaccgctat
gctgctatctgccacccactgctctacccacttctcatgactccttgtagatgtgaagtt
cttgccagtgggtcatggggagtagctcattgcgtgtctttgttctatactttattgctc
tctcagttatattttcaaaccaatgaagggatacctcattttttctgtgattctaggcct
ctcttattactttcctgctctgacaatcatctcaatgagggcctgatgatgggtttgtct
gcagtaatgggaatcagtgcacttttctgcattttaagttcttatgcttctatttttcat
gctgtggctagagttccatcagcacaggggaaaaggaaagccttagccacatgtagttcc
cacttctctgtagtcctccttttccacagcacagtctttgccacctacctgaagccccca
tctacttctcactcctctggggaggtggtagctgctgttttgtataccttggtaactccc
actctgaacccgttcatttatagtctgagaaatagggatgttaagagttccttgagaagg
atcctgaacatagagaagtctcaggactaa

DBGET integrated database retrieval system