KEGG   Rattus norvegicus (rat): 29419Help
Entry
29419             CDS       T01003                                 

Gene name
Numb
Definition
(RefSeq) NUMB, endocytic adaptor protein
  KO
K06057  numb
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    29419 (Numb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    29419 (Numb)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    29419 (Numb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PID NumbF PTB PID_2
Motif
Other DBs
NCBI-GeneID: 29419
NCBI-ProteinID: NP_579821
RGD: 620107
Ensembl: ENSRNOG00000009653
UniProt: Q3MUI1
Position
6q24
AA seq 592 aa AA seqDB search
MNKLRQSFRRKKDVYVPEASRPHQWQTDEEGVRTGKCSFPVKYLGHVEVDESRGMHICED
AVKRLKATGKKAVKAVLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPDRNFDRAFSYIC
RDGTTRRWICHCFMAVKDTGERLSHAVGCAFAACLERKQKREKECGVTATFDASRTTFTR
EGSFRVTTATEQAEREEIMKQLQDAKKAETDKTVGPSVAPGNSAPSPSSPTSPTLDPTAS
LEMNNPHAIPRRHAPIEQLARQGSFRGFPALSQKMSPFKRQLSLRINELPSTMQRKTDFP
IKNTVPEVEGEAESISSLCSQITSAFSTPCEDPFSSAPMTKPVTLVAPQSPVLQGTEWGQ
SSGAASPGLFQAGHRRTPSEADRWLEEVSKSVRAQQPQASAAPLQPVLQPPPPAAIAPPA
PPFQGHAFLTSQPVPVGVVPPLQPAFVSTQSYPVANGMPYPASNVPVVGITPSQMVANVF
GTAGHPQATHPHQSPSLAKQQTFPQYETSSATTSPFFKPSAQHLNGSAAFNGVDNSGLVS
GNRPAQVPPGTCPVDPFEAQWAALESKPKQRTNPSPTNPFSSDAQKAFEIEL
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaactacggcagagtttcaggagaaagaaagatgtttacgtcccagaggccagc
cgtccacatcagtggcagacagatgaagagggagtccgcactggaaagtgcagcttccca
gttaagtaccttggccacgtagaggttgatgagtcaagaggaatgcacatctgtgaagat
gccgtcaaaagattgaaagctacgggaaagaaagcagtgaaggccgttctgtgggtatca
gcagatggactcagagttgtggatgaaaaaactaaggacctcatagttgaccagacaata
gaaaaagtttctttctgcgcccccgataggaactttgacagagccttttcttacatatgt
cgagatggcaccactcggcgatggatctgtcattgcttcatggctgtcaaagacacgggg
gaaagactgagccatgccgtgggctgtgcttttgcagcctgtttagagcgtaaacagaag
cgggaaaaggagtgtggagtcactgctactttcgatgccagtagaaccacttttacaaga
gaaggatcattccgtgtcacaactgccacagaacaagctgaaagagaggagatcatgaaa
cagttgcaagatgccaagaaagctgagacagataagaccgttggtccatcagtggctcct
ggcaacagtgctccatcgccgtcctctcccacctccccaactctggatcccactgcttct
ttagagatgaacaatcctcatgctatcccacgccggcatgcaccaattgaacagcttgct
cgccaaggctctttccggggatttcctgctcttagccagaagatgtcaccctttaaacgc
cagctgtccctacgcatcaatgagctgccttccactatgcagaggaagactgatttccca
ataaaaaacacagtgcctgaggtggaaggagaggcagaaagcatcagctccctgtgctcc
cagatcaccagtgccttcagcacaccctgtgaggaccccttctcctctgccccaatgacc
aaaccagtgacattagtggcaccacagtctcctgtgttacaagggactgagtggggtcag
tcttctggtgctgcctctccaggtctcttccaggctggtcacagacgcactccctctgag
gctgaccgttggttagaagaagtatcaaaaagtgtgcgggcccagcagccgcaggcctca
gccgcccctctgcagccagttctgcagcctcctccgcccgctgccattgcccctccagca
cctcctttccaaggacatgcattcctcacttctcagcctgtgccagtgggtgtggtccca
cccctacaaccagcctttgtctctacccagtcctaccctgtggccaatgggatgccctat
ccagcctctaatgtgcctgtagtgggcatcaccccatcccagatggtagccaatgtgttt
ggcactgcaggccatcctcaggccactcatccacatcagtccccaagcctggccaagcag
cagacattccctcaatatgagacaagtagtgctaccaccagtcccttctttaagccttct
gctcagcacctcaatggttctgcagctttcaatggtgtagacaatagcgggctagtctca
ggaaacagacctgcacaagtccctccaggcacctgcccagtggatccttttgaggcccag
tgggctgcactagaaagcaagcccaagcagcgcaccaacccctctcctaccaaccctttc
tccagtgatgcacagaaggcatttgaaatagagctttag

DBGET integrated database retrieval system