KEGG   Rattus norvegicus (rat): 29422Help
Entry
29422             CDS       T01003                                 

Gene name
Chrne, nAChR
Definition
(RefSeq) cholinergic receptor nicotinic epsilon subunit
  KO
K04817  nicotinic acetylcholine receptor epsilon
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    29422 (Chrne)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    29422 (Chrne)
Ion channels [BR:rno04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   29422 (Chrne)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Motif
Other DBs
NCBI-GeneID: 29422
NCBI-ProteinID: NP_058890
RGD: 2353
Ensembl: ENSRNOG00000003777
UniProt: P09660
Position
10q24
AA seq 494 aa AA seqDB search
MTMALLGTLLLLALFGRSQGKNEELSLYHHLFDNYDPECRPVRRPEDTVTITLKVTLTNL
ISLNEKEETLTTSVWIGIEWQDYRLNFSKDDFAGVEILRVPSEHVWLPEIVLENNIDGQF
GVAYDCNVLVYEGGSVSWLPPAIYRSTCAVEVTYFPFDWQNCSLIFRSQTYNAEEVELIF
AVDDDGNAINKIDIDTAAFTENGEWAIDYCPGMIRHYEGGSTEDPGETDVIYTLIIRRKP
LFYVINIIVPCVLISGLVLLAYFLPAQAGGQKCTVSINVLLAQTVFLFLIAQKIPETSLS
VPLLGRYLIFVMVVATLIVMNCVIVLNVSLRTPTTHATSPRLRQILLELLPRLLGLSPPP
EDPGAASPARRASSVGILLRAEELILKKPRSELVFEGQRHRHGTWTAAALCQNLGAAAPE
VRCCVDAVNFVAESTRDQEATGEELSDWVRMGKALDNVCFWAALVLFSVGSTLIFLGGYF
NQVPDLPYPPCIQP
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacaatggctctgcttgggaccctgcttctcctggcactctttggcagaagccaaggc
aagaatgaagagctgagcctgtatcaccatctcttcgacaattatgacccagaatgccgg
ccagttaggagacctgaggacactgtcaccatcaccctcaaggtcaccctaaccaacctc
atctcactgaatgagaaagaagagactctgaccaccagtgtctggattggaattgaatgg
caagactatcggctcaacttcagcaaggacgattttgcaggcgtagaaatcctgcgggtc
ccttccgaacatgtatggctgccagagattgttctggaaaacaatattgatgggcagttt
ggagtggcctacgactgcaatgttctggtctatgagggaggctctgtgagctggctgccc
ccagctatctaccgcagcacgtgcgcagtggaggtcacctatttcccctttgactggcag
aactgctctctcatttttcgttcccagacctacaatgctgaagaggtggagttaatcttt
gcagtggatgacgatggcaatgccatcaacaaaattgacatcgacaccgcagcttttacc
gagaatggagaatgggccattgactactgcccaggcatgattcgccattatgagggaggc
tccacagaagaccctggagaaactgacgtcatctacacgctcatcatccgtcgaaagccg
cttttttacgtcattaacatcattgtgccttgtgtgctcatttctggcttggtgctactc
gcttacttcctacctgcgcaggctggtggccagaaatgcacggtctctatcaacgtcctg
ctagcccagactgtcttcttgttcctaattgcccagaaaattccagagacttctctgagc
gtgccgctgctgggcaggtatcttatttttgtcatggtggttgccacgctcattgtcatg
aattgcgtcatcgtgctcaacgtatctttgcgaacgccaacgactcacgccacatcccct
cggctgcgccagattttattagagctactgccgcgcctcctcggcttgagcccaccccca
gaggatcccggagctgcctcaccagcgaggcgtgcctcatctgtgggcattctgcttaga
gcggaggagctcatcttgaaaaagccgcggagcgaactcgtgtttgagggacagaggcat
cggcatggaacttggaccgcagccgccctctgccagaacctgggtgctgcagcccctgaa
gtccgctgctgtgtggatgctgtgaactttgtggctgagagcacaagggaccaggaagcc
actggagaggaactgtctgactgggtgcgtatggggaaggccctcgacaatgtctgtttt
tgggcagcgttggtgctcttcagcgtcggttctacgctcatcttccttggaggttacttc
aaccaagttcctgatctcccctacccaccgtgcatccaaccatga

DBGET integrated database retrieval system