KEGG   Rattus norvegicus (rat): 29423
Entry
29423             CDS       T01003                                 

Gene name
Gap43, Basp2
Definition
(RefSeq) growth associated protein 43
  KO
K20041  neuromodulin
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    29423 (Gap43)
Membrane trafficking [BR:rno04131]
 SNARE
  SNARE associated proteins
   Others
    29423 (Gap43)
SSDB
Motif
Pfam: Neuromodulin Neuromodulin_N IQ
Other DBs
NCBI-GeneID: 29423
NCBI-ProteinID: NP_058891
RGD: 62071
Ensembl: ENSRNOG00000001528
UniProt: P07936
Position
11q21
AA seq 226 aa
MLCCMRRTKQVEKNDEDQKIEQDGVKPEDKAHKAATKIQASFRGHITRKKLKDEKKGDAP
AAEAEAKEKDDAPVADGVEKKEGDGSATTDAAPATSPKAEEPSKAGDAPSEEKKGEGDAA
PSEEKAGSAETESAAKATTDNSPSSKAEDGPAKEEPKQADVPAAVTDAAATTPAAEDAAK
AAQPPTETAESSQAEEEKEAVDEAKPKESARQDEGKEDPEADQEHA
NT seq 681 nt   +upstreamnt  +downstreamnt
atgctgtgctgtatgagaagaaccaaacaggttgaaaagaatgatgaggaccaaaagatt
gaacaagatggtgtcaaaccggaggataaggctcataaggctgcaaccaaaattcaggct
agcttccgtggacacataacaaggaaaaagctcaaagacgagaagaagggtgatgcacca
gctgctgaggccgaggccaaggagaaggatgatgctcccgttgctgatggtgtggagaag
aaggagggagatggctctgctactaccgatgcagccccagccaccagccctaaggctgag
gagcccagcaaggcaggagatgcaccttctgaggagaagaagggcgaaggggatgcggcc
ccttcagaggaaaaggccggctcagctgagacagaaagtgctgctaaagctaccactgat
aactcgccgtcctccaaggccgaagatggcccagccaaggaggagcctaaacaagccgat
gtgcctgctgctgtcactgatgctgctgccaccacccctgctgcagaggatgctgccaag
gcagcgcagcctccaacggagactgcagaaagcagccaagctgaggaggagaaagaagct
gtagatgaagccaaacctaaggaaagtgcccgacaggatgagggtaaagaagaccccgag
gctgaccaagaacatgcctga

DBGET integrated database retrieval system