KEGG   Rattus norvegicus (rat): 29424Help
Entry
29424             CDS       T01003                                 

Gene name
Htt, Hd, Hdh
Definition
(RefSeq) huntingtin
  KO
K04533  huntingtin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    29424 (Htt)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    29424 (Htt)
   04131 Membrane trafficking [BR:rno04131]
    29424 (Htt)
   03029 Mitochondrial biogenesis [BR:rno03029]
    29424 (Htt)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     29424 (Htt)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    29424 (Htt)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    29424 (Htt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3652 HEAT HEAT_2 HEAT_EZ
Motif
Other DBs
NCBI-GeneID: 29424
NCBI-ProteinID: NP_077333
RGD: 68337
Ensembl: ENSRNOG00000011073
UniProt: G3V9P7
Position
14q21
AA seq 3120 aa AA seqDB search
MATLEKLMKAFESLKSFQQQQQQQQPPPQAPPPPPPPPPQPPQPPPQGQPPPPPPLPGPA
EEPLHRPKKELSATKKDRVNHCLTICENIVAQSLRNSPEFQKLLGIAMELFLLCSDDAES
DVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALWRFAELAHLVRPQK
CRPYLVNLLPCLTRTSKRPEESVQETLAAAVPKIMASFGNFANDNEIKVLLKAFIANLKS
SSPTVRRTAAGSAVSICQHSRRTQYFYNWLLNVLLGLLVPMEEDHPTLLILGVLLTLRCL
VPLLQQQVKDTSLKGSFGVTRKEMEVSPSAEQLVQVYELTLHHTQHQDHNVVTGALELLQ
QLFRTPPPELLQALTTPGGLGQLTLVREEAGGRGRSGSIVELLAGGGSSCSPVLSRKQKG
KVLLGEEEALEDDSESRSDVSSSAFAASVKSEIGGELAASSSGVSTPGSVGHDIITEQPR
SQHTLQADSVDLSGCDLTSAATDGDEEDILSHSSSQFSAVPSDPAMDLNDGTQASSPISD
SSQTTTEGPDSAVTPSDSSEIVLDGADSQYLGVQIGQPQEEDEEEAAGVLSGEVSDVFRN
SSLALQQAHLLERMGHSRQPSDSSVDKFVSKDEVAEAGDPESKPCRIKGDIGQPNDDDSA
PLVHCVRLLSASFLLTGEKKALVPDRDVRVSVKALALSCIGAAVALHPESFFSKLYKVPL
STMESTEEQYVSDILNYIDHGDPQVRGATAILCGTLVYSILSRSRLRVGDWLGTIRALTG
NTFSLVDCIPLLQKTLKDESSVTCKLACTAVRHCVLSLCSSSYSDLGLQLLIDMLPLKNS
SYWLVRTELLETLAEIDFRLVSFLEAKAESLHRGAHHYTGFLKLQERVLNNVVIYLLGDE
DPRVRHVAATTLTRLVPKLFYKCDQGQADPVVAVARDQSSVYLKLLMHETQPPSHFSVST
ITRIYRGYSLLPSVTDVTMENNLSRVVAAVSHELITSTTRALTFGCCEALCVLSAAFPVC
TWSLGWHCGVPPLSASDESRKSCTVGMASMILTLLSSAWFPLDLSAHQDALILAGNLLAA
SAPKSLRSSWASEEEGSSAATRQEEIWPALGDRTLVPMVEQLFSHLLKVINICAHVLDDV
TPGPAIKAALPSLTNPPSLSPIRRKGKEKEPGEQTSTPMSPKKGGEASTASRQSDTSGPV
TASKSSSLGSFYHLPSYLRLHDVLKATHANYKVTLDLQNSTEKFGGFLRSALDVLSQILE
LATLQDIGKCVEEVLGYLKSCFSREPMMATVCVQQLLKTLFGTNLASQFDGLSSNPSKSQ
CRAQRLGSSSVRPGLYHYCFMAPYTHFTQALADASLRNMVQADQEHDASGWFDVLQKVSA
QLKTNLTSVTKNRADKNAIHNHIRLFEPLVIKALKQYTTTTSVQLQKQVLDLLAQLVQLR
VNYCLLDSDQVFIGFVLKQFEYIEVGQFRESEAIIPNIFFFLVLLSYERYHSKQIIGIPK
IIQLCDGIMASGRKAVTHAIPALQPIVHDLFVLRGTNKADAGKELETQKEVVVSMLLRLI
QYHQVLEMFILVLQQCHKENEDKWKRLSRQVADIILPMLAKQQMHIDSHEALGVLNTLFE
ILAPSSLRPVDMLLRSMFITPSTMASVSTVQLWISGILAILRVLISQSTEDIVLSRIQEL
SFSPYLISCPVINRLRDGDSNPTLGERSEGKQVKNLPEDTFSRFLLQLVGILLEDIVTKQ
LKVDMSEQQHTFYCQELGTLLMCLIHIFKSGMFRRITAAATRLFTSDGCEGSFYTLDSLN
ARVRAMVPTHPALVLLWCQILLLINHTDHRWWAEVQQTPKRHSLSCTKSLNPQISAEEDS
GSAAQLGMCNREIVRRGALILFCDYVCQNLHDSEHLTWLIVNHIQDLISLSHEPPVQDFI
SAIHRNSAASGLFIQAIQSRCENLSTPTTLKKTLQCLEGIHLSQSGAVLTLYVDRLLGTP
FRALARMVDTLACRRVEMLLAANLQSSMAQLPEEELNRIQEHLQNTGLAQRHQRLYSLLD
RFRLSTVQDSLSPLPPVTSHPLDGDGHTSLETVNPDKDWYLQLVRSQCWTRSDSALLEGA
ELVNRIPAEDMSDFMMSSEFNLSLLAPCLSLGMSEIANGQKSPLFEAARRVTLDRVTNVV
QQLPAVHQVFQPFLPTEPTAYWSKLNDLFGDTTSYQSLTTLARALAQYLVVLSKVPAPLH
LPPEKEGHTVKFVVMTLEALSWHLIHEQIPLSLDLQAGLDCCCLALQVPGLWGVLSSPEY
VTHTCSLIHCVRFILEAIAVQPGDQLLGPESRSHTPRAVRKEEVDSDIQNLSHITSACEM
VADMVESLQSVLALGHKRNSTLPSFLTAVLKNIVVSLARLPLVNSYTRVPPLVWKLGWSP
KPGGDFGTVFPEIPVEFLQEKEVLKEFIYRINTLGWTSRTQFEETWATLLGVLVTQPLVM
EQEESPPEEDTERTQIHVLAVQAITSLVLSAMAVPVAGNPAVSCLEQQPRNKPLKALDTR
FGRKLSMIRGIVEQEIQEMVSQRENTATHHSHQAWDPVPSLLPATTGALISHDKLLLQIN
SEREPGNMSYKLGQVSIHSVWLGNNITPLREEEWDEEEEEEADAPAPTSPPVSPVNSRKH
RAGVDIHSCSQFLLELYSRWILPSSAARRTPVILISEVVRSLLVVSDLFTERTQFEMMYL
TLTELRRVHPSEDEILIQYLVPATCKAAAVLGMDKTVAEPVSRLLESTLRSTHLPSQIGA
LHGILYVLECDLLDDTVKQLIPVVSDYLLSNLKGIAHCVNIHSQQHVLVMCATAFYLMEN
YPLDVGPEFSASVIQMCGVMLSGSEESTPSIIYHCALRGLERLLLSEQLSRLDTESLVKL
SVDRVNVQSPHRAMAALGLMLTCMYTGKEKASPGRASDPSPATPDSESVIVAMERVSVLF
DRIRKGFPCEARVVARILPQFLDDFFPPQDVMNKVIGEFLSNQQPYPQFMATVVYKVFQT
LHSAGQSSMVRDWVMLSLSNFTQRTPVAMAMWSLSCFLVSASTSPWVSAILPHVISRMGK
LEQVDVNLFCLVATDFYRHQIEEEFDRRAFQSVFEVVAAPGSPYHRLLACLQNVHKVTAC
NT seq 9363 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccctggaaaaactgatgaaggctttcgagtcgctcaagtcgttccagcagcaa
cagcagcagcagcagccgccgccgcaggcgccgccaccaccgccgccgccgccgcctcaa
ccccctcagccgccgcctcaggggcagccgccgccaccaccgccgctgccaggtccggcc
gaggagccgctgcaccgaccaaagaaggaactctcagccaccaagaaggaccgtgtgaat
cactgtctaacaatatgtgaaaacattgtggcacagtctctcagaaattctccagaattt
cagaaactcttgggcattgctatggaactgtttctgctgtgcagcgacgatgcggagtca
gacgtcagaatggtggctgatgagtgcctcaacaaagtcatcaaagctttgatggactct
aatcttccaaggctacagttagaactctataaggaaattaaaaagaatggtgctcctcga
agtttgcgtgcagctctgtggaggtttgctgagctggctcacctggttcgacctcagaag
tgcaggccttatctggtgaatcttcttccatgtttgacccgaacaagcaaacgaccggag
gagtcagttcaggagactttggctgcagctgttcctaaaattatggcctcttttggcaat
ttcgcgaatgacaatgaaattaaggttctattgaaagctttcatagcaaatctgaagtca
agctctcccactgtgcggcggacagcagctgggtcagcagtgagtatctgccagcactct
aggaggacacagtacttctacaactggctcctgaatgtgctcctaggtttgctggttccc
atggaggaagaccaccccactctcctgatccttggtgtgttgctcacactgaggtgtcta
gtgcccttgctccagcagcaggtcaaggacacaagtctaaagggcagctttggggtaaca
cggaaagaaatggaagtctctccttctgcagagcagcttgtccaggtttatgaactgact
ttgcatcacacacagcaccaagaccataatgtggtgacaggggcattggagctcctgcag
cagctcttccgtacccctccacctgagctgctgcaagcactgaccacaccaggagggctc
gggcagctcactctggttcgagaggaagccgggggccgaggccgcagcgggagtatcgtg
gagcttttagctggagggggttcctcatgcagccctgttctctcaagaaagcaaaaaggc
aaagtgctcttaggagaggaagaagccttggaggatgactcggagtccaggtcagatgtc
agcagctcagcctttgcagcctctgtgaagagtgagattggtggagagctcgctgcttct
tcttcgggtgtctccactcccggttctgtaggtcacgacatcatcactgagcagcctcga
tcccagcacacacttcaagcagactctgtggatttgtcaggctgtgacttgaccagtgct
gctactgatggagatgaggaagacatcttgagccacagctccagccagttcagtgctgtt
ccatccgaccctgccatggacctgaatgatgggacccaggcctcctcacccatcagtgac
agttctcagaccaccactgaaggacctgattcagctgtgactccttctgacagttctgaa
attgtcttagatggtgctgacagccagtatttaggcgtgcagataggacagccacaggag
gaagacgaggaggaagctgcaggtgttctttctggtgaagtctcagacgttttcagaaac
tcttctctggcccttcagcaggcacacttgttggaaagaatgggtcatagccggcagcct
tctgacagcagtgttgataagtttgtttcaaaagatgaggttgctgaagctggggaccca
gaaagcaagccttgccgaatcaaaggtgacataggacagcctaatgatgatgattctgct
cctctggtacattgtgtccgtcttttatccgcttcctttttgttaactggcgaaaagaaa
gcactggttccagacagagatgtgagagtcagtgtgaaggccctggccctcagctgtatt
ggtgcagctgtggcccttcatccagagtcgttcttcagcaaactctacaaagtacctctc
agtaccatggaaagtactgaggaacagtatgtctctgacatcctgaactacatcgatcat
ggagaccctcaggtgcgaggagctactgccattctctgtgggacccttgtctactccatc
ctcagcaggtcccgtctccgtgttggtgactggctgggcaccatcagggccctgacagga
aatacattttctctggtggactgcattcctttactgcagaaaactttgaaggatgaatct
tctgttacttgcaagttggcttgtacagctgtgaggcactgtgtcctgagtctttgcagc
agcagctacagtgacttgggattacaactgcttattgacatgctgcctctgaagaacagc
tcctactggctggtgaggactgaactgctggaaactcttgcagagattgatttcaggctg
gtgagttttttggaggcaaaagcagaaagtttacaccgaggggctcatcattatacaggg
tttctaaaactacaagaacgagtactcaataatgtggtcatttatttgcttggagatgaa
gaccccagggttcgacatgttgctgcgacgacattgacaagacttgtcccaaagctgttt
tataagtgtgaccaaggacaggctgacccagtcgtggctgtagcaagagatcaaagtagt
gtttacctgaagctcctcatgcatgagacccagccaccatcccacttctccgtcagcacc
ataaccagaatctatagaggctacagcttactaccaagtgtaacagatgtcaccatggaa
aacaacctctcaagagtcgttgccgcagtttctcatgaactcattacgtcaactacacgg
gcactcacatttgggtgctgtgaagccttgtgtgttctttcagccgcctttccagtttgc
acttggagtctaggatggcactgtggagtgcccccactgagtgcctctgatgagtccagg
aagagctgcactgttgggatggcctccatgattctcaccttgctttcatcagcttggttc
ccactggatctctcagcccatcaggatgccttgattttggctggaaacttgctagcagcg
agtgcccccaagtctctgagaagctcatgggcctcggaagaagaaggcagctcagcagcc
accagacaggaggagatctggcctgccctgggggatcggactctggtgcccatggtggag
cagcttttctcccacctgctgaaggtgatcaatatctgtgctcatgtcttggatgacgtg
actcctggaccagcaatcaaggcagctttgccttctctcacaaaccccccttctctaagt
cctattcgacggaaagggaaggagaaagagcccggagaacaaacatccactccgatgagt
cccaagaaaggtggagaggccagtacagcctctcgacagtcagacacctcaggacctgtc
acagcgagtaaatcatcttcacttgggagtttctaccatctcccttcctacctcagactg
catgatgtcctgaaagccactcacgccaactataaggtcaccttagatcttcagaacagc
actgaaaagtttggggggttcctgcgctctgccttggacgtcctttctcagattctagag
ctggcgacactgcaggacattggaaagtgtgttgaagaggtccttggatacttgaaatcc
tgctttagtcgagaaccaatgatggcgactgtctgtgttcagcagctattgaagactctc
tttgggacaaacttagcctcacagtttgatggcttatcttccaaccccagcaagtctcag
tgccgagcacagcgccttggctcttccagtgtgaggcccggcttatatcactactgcttc
atggcaccatacacgcacttcacgcaggctttggctgatgccagcctgaggaacatggta
caggcggaccaggagcacgatgcctcagggtggtttgatgtactccagaaagtgtctgct
cagttgaagacgaaccttacaagtgtcacaaagaaccgtgcagataagaacgctattcat
aaccacattaggttatttgagcctcttgttataaaagcattgaagcagtacaccacgaca
acatcagtacaactgcagaagcaggttttggatttgctggcacagctggttcagctacgg
gtcaattactgtctactggattcagatcaggtgttcatcgggtttgtgctgaagcagttt
gagtacattgaagtgggccagttcagggaatcagaggcaattattccaaatatatttttc
ttcctggtactattatcttatgagcgctaccattcaaaacagatcattggaattcctaaa
atcatccagctgtgtgatggcatcatggccagtggaaggaaggctgtcacacatgctatt
cctgcgctgcagcccattgtccatgacctctttgtgttaagaggaacaaataaagctgat
gcagggaaagagcttgaaacccagaaggaggtggtggtctcaatgctgttacgactcatc
cagtaccatcaggtgctagagatgttcatcctcgtcctgcagcagtgccacaaagagaat
gaggacaagtggaaacggctctctcggcaggtcgcagacatcatcctgcccatgttagcc
aagcagcagatgcatattgactctcatgaagcccttggagtattaaataccttgtttgag
attttggctccttcctccctacgtcctgtggacatgcttttgcggagtatgttcatcact
ccaagcacaatggcatctgtaagcactgtgcagctgtggatatctggaatcctagccatt
ctgagggttctcatttcccagtcaaccgaagacattgttctttctcgtattcaggagctc
tccttctctccatatttaatttcctgtccagtaattaacaggttaagggatggagacagt
aatccaacactaggagaacgcagtgaagggaaacaagtaaagaatttgccagaagataca
ttctcaaggtttctcttacagctggttggtattcttctggaagacattgttacaaaacag
ctcaaagtggacatgagtgaacagcagcatacattctattgccaagagctcggcacactg
ctcatgtgtctgatccacatattcaaatctggaatgttccggagaatcacagccgctgcc
actagactcttcaccagtgatggctgtgaaggcagcttctatactctagatagcctgaat
gcacgggtgcgagccatggtgcccacacacccagctctggtactgctctggtgtcagatc
ctactgctcatcaaccacactgaccaccgatggtgggccgaggtgcagcagacgcccaag
agacacagtctgtcctgcacgaagtcactaaacccccagatatctgctgaagaggattct
ggctcagcagctcagcttggaatgtgcaatagagaaatagtacgaagaggggcccttatt
ctcttctgtgattatgtctgtcagaatctccatgactcagaacacttaacatggctcatt
gtgaatcacattcaagatctgatcagcttgtcccacgagcctccagttcaagactttatt
agtgccattcatcgtaattctgcagctagtggtctttttatccaggcaattcagtctcgc
tgtgaaaatctttcaactccaaccactctgaagaaaacacttcagtgcttggaaggcatc
catctcagccagtctggtgctgtgctcacactgtatgtggacaggctactgggcacccct
ttccgtgcgctggctcgcatggtcgacaccctggcctgtcgccgagtagaaatgcttttg
gctgcaaatttacagagcagcatggcccagttgccagaggaggaactgaacagaatccag
gaacacctccagaacactgggcttgcacaaagacaccaaaggctctattcactgctggac
agattccgactctctactgtgcaggactcacttagccccttgcccccagtcacttcccac
cctctggatggggatgggcacacatccctggaaacagtgaatccggacaaagactggtac
ctccagcttgtcagatcccagtgttggaccaggtcagattctgcactgctggaaggtgca
gagctggtgaaccgtatccctgctgaagatatgagtgacttcatgatgagctcggagttc
aacctaagccttttggctccctgcttaagccttggcatgagcgagattgctaatggccaa
aagagtcccctttttgaagcggctcgtagggtgactctggaccgggtgaccaatgtggtt
cagcagctgcctgcagtccatcaagtcttccagcctttcctgcctacagaacccacagcc
tactggagcaagctgaatgatctctttggtgataccacatcataccagtctctgaccaca
cttgcccgtgccctggcacagtacctggtggtgctctccaaagtgcctgctcctttgcac
cttcctcctgagaaggaggggcacacggtgaagtttgtggtaatgacacttgaggccctg
tcatggcatttgatccatgagcagatcccactgagtctggacctccaagccggcctagac
tgctgctgcctggcactgcaggtgcctggcctctggggggtgctgtcctccccagagtac
gtgactcatacttgctcccttatccactgtgtgcgattcatcctggaagccattgcagta
caacctggagaccaacttcttggtccggaaagcaggtcacatactccaagggctgtcaga
aaggaggaagtagactcagatatacaaaacctcagtcacatcacttcggcctgcgagatg
gtggcagacatggtggaatccctgcagtcggtgctggccctgggccacaagaggaacagc
accctaccttcatttctcacagctgtgctgaagaacattgttgtcagtctggcccgcctc
cccctcgttaacagctatactcgtgtgcctcctctggtatggaaactcgggtggtcaccc
aagcctggaggggatttcggcacagtgtttcctgagatccctgtagagttcctccaggag
aaggaggtcctcaaggagttcatctaccgcatcaacaccctagggtggaccagtcgtact
caattcgaagaaacttgggccaccctccttggtgtcctggtgactcagcccttggtgatg
gaacaggaagagagcccaccagaggaagacaccgaaaggacccagatccacgtcctggct
gtacaggccatcacctctctagtgctcagcgcaatggctgtgcctgtggctggcaatcca
gctgtaagctgcttggagcaacagccccggaacaagccactgaaggctctcgataccaga
tttggaagaaagttgagcatgatcagagggattgtagaacaagaaatccaagagatggtt
tcccaaagagagaatactgccactcatcattctcaccaggcatgggatcctgtcccttct
ctgttaccagctactacaggtgctcttatcagccatgacaagctgctgctgcagatcaac
tcagagcgggagccaggcaacatgagctacaagctgggccaggtgtccatacactccgtg
tggctggggaacaacatcacacccctgagagaggaggaatgggatgaggaggaggaggaa
gaagcggatgcccctgcgccaacatcaccacctgtgtctccagtcaattccagaaaacac
cgtgctggggttgatattcactcctgttcgcagtttctgcttgaattatacagccgttgg
atcctgccatccagtgcagccagaaggacccctgtcatcctgatcagtgaagtggttcga
tctcttcttgtggtgtcagacttattcactgaacgtacccagtttgaaatgatgtatctg
acgctgacagaactacggagagtgcacccttcagaagatgagatcctcattcaatacctg
gtgcctgccacctgtaaggcagctgctgttcttggaatggacaaaactgtggcagagccg
gtcagccgcctactggagagcacactcaggagcacccacctgcccagccagatcggagcc
ctgcatggcatcctctatgtgttggagtgtgacctcttggatgacactgtaaagcagctc
attccagttgttagtgactatctgctgtccaacctcaaaggaatagcccactgcgtgaac
attcacagccagcagcatgtgctggtgatgtgtgccactgcattctacctgatggaaaac
taccctctggatgtggggccagaattctcagcatctgtgatacagatgtgtggagtaatg
ctgtctggaagtgaggagtccaccccctccatcatttaccactgtgccctccggggtctg
gaacggctcctgctgtctgagcagctctctcggctagacacggagtccttggtcaagcta
agtgtggacagagtgaatgtacaaagcccacacagggccatggcagccctaggcctgatg
cttacctgcatgtacacaggaaaggaaaaagccagtccaggcagagcttctgaccccagc
cctgctacccctgacagcgagtctgtgattgtagctatggagcgagtgtctgtgctcttt
gacaggatccgcaagggatttccctgtgaagccagggtcgtggcaaggatcctgcctcag
tttctagatgacttctttccacctcaagatgtcatgaacaaagtcattggagagttcctg
tccaaccagcagccatacccacagttcatggccactgtagtatacaaggtttttcagact
ctgcacagtgctgggcagtcatccatggtccgggactgggttatgctgtctctgtccaac
ttcacacaaagaactccagttgccatggccatgtggagcctctcctgcttccttgtcagt
gcatctaccagcccatgggtttctgcaatccttccacacgtcatcagcaggatgggcaaa
ctggagcaggtggatgtgaaccttttctgcctggttgccacagacttctacagacaccag
atagaggaggaattcgaccgcagggctttccagtctgtgtttgaggtggtggcagcacca
ggaagtccataccacaggctgcttgcttgtttgcaaaatgttcacaaggtcaccgcctgc
tga

DBGET integrated database retrieval system